CREB3 antibody - middle region (ARP38790_P050)

Catalog#: ARP38790_P050

• Size: 50ug

Human HepG2

• Description of Target: CREB3 is a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds to the cAMP-responsive element, an octameric palindrome. The protein interacts with host cell factor C1, which also associates with the herpes simplex virus (HSV) protein VP16 that induces transcription of HSV immediate-early genes. This protein and VP16 both bind to the same site on host cell factor C1. It is thought that the interaction between this protein and host cell factor C1 plays a role in the establishment of latency during HSV infection. An additional transcript variant has been identified, but its biological validity has not been determined. This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds to the cAMP-responsive element, an octameric palindrome. The protein interacts with host cell factor C1, which also associates with the herpes simplex virus (HSV) protein VP16 that induces transcription of HSV immediate-early genes. This protein and VP16 both bind to the same site on host cell factor C1. It is thought that the interaction between this protein and host cell factor C1 plays a role in the establishment of latency during HSV infection. An additional transcript variant has been identified, but its biological validity has not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Gene Symbol: CREB3
• Official Gene Full Name: CAMP responsive element binding protein 3
• Alias Symbols: LUMAN; LZIP; MGC15333; MGC19782
• Protein Accession#: NP_006359
• Nucleotide Accession#: NM_006368
• Swissprot Id: O43889
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 371
• Molecular Weight: 41kDa
• Application: WB
• Partner Proteins: ALOX12, APBB1, APP, AR, ARIH2, ATM, ATXN1, BARD1, BCL3, BMI1, C1orf174, CBX8, CCDC106, CCNB1, CCT7, CDC42, CDK1, CDK5RAP2, CREB1, CREBBP, CRELD1, CSTF2, E2F1, EDNRA, EFNA1, EP300, ESR1, ETV6, FAM101B, FAM135B, FAM173A, GADD45G, GAPDH, GEMIN7, GET4, GSTO1, H3F3B, HABP4, HAP1, HDAC1, HDAC7, HIST2H
• Immunogen: The immunogen for anti-CREB3 antibody: synthetic peptide directed towards the middle region of human CREB3
• Product Format: Lyophilized powder
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Bovine: 80%
• Peptide Sequence: Synthetic peptide located within the following region: PPLEWPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGSPSVILQDRYSG
• Blocking Peptide: For anti-CREB3 antibody is Catalog # AAP38790 (Previous Catalog # AAPP20995)
• Key Reference: Mamdani,F., (er) Am. J. Med. Genet. B Neuropsychiatr. Genet. (2008) In press
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-CREB3 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: CREB3 antibody tested with Human Hepg2 Cells (ARP38790_P050)

Aviva Systems Biology is the original manufacturer of this CREB3 antibody (ARP38790_P050)

Click here to view the CREB3 antibody Western Blot Protocol

Product Datasheet Link: CREB3 antibody (ARP38790_P050)

WB Suggested Anti-CREB3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2

Western Blot image:


Description of Target: CREB3 is a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds to the cAMP-responsive element, an octameric palindrome. The protein interacts with host cell factor C1, which also associates with the herpes simplex virus (HSV) protein VP16 that induces transcription of HSV immediate-early genes. This protein and VP16 both bind to the same site on host cell factor C1. It is thought that the interaction between this protein and host cell factor C1 plays a role in the establishment of latency during HSV infection. An additional transcript variant has been identified, but its biological validity has not been determined. This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds to the cAMP-responsive element, an octameric palindrome. The protein interacts with host cell factor C1, which also associates with the herpes simplex virus (HSV) protein VP16 that induces transcription of HSV immediate-early genes. This protein and VP16 both bind to the same site on host cell factor C1. It is thought that the interaction between this protein and host cell factor C1 plays a role in the establishment of latency during HSV infection. An additional transcript variant has been identified, but its biological validity has not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s CREB3 antibody (ARP38790_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com