- Description of Target:
- Phosphoinositide 3-kinases (PI3Ks) phosphorylate the 3-prime OH position of the inositol ring of inositol lipids. They have been implicated as participants in signaling pathways regulating cell growth by virtue of their activation in response to various mitogenic stimuli. PI3Ks are composed of a 110-kD catalytic subunit, such as PIK3CB, and an 85-kD adaptor subunit (Hu et al., 1993).[supplied by OMIM].
- Gene Symbol:
- PIK3CB
- Official Gene Full Name:
- Phosphoinositide-3-kinase, catalytic, beta polypeptide
- Alias Symbols:
- PI3K; PIK3C1; P110BETA; PI3KBETA
- Tissue Tool:
- Find tissues and cell lines supported to express PIK3CB.

- Protein Accession# :
- NP_006210
- Nucleotide Accession#:
- NM_006219
- Swissprot Id:
- Q24JU2
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 1070
- Molecular Weight:
- 123kDa
- Application:
- WB
- Subunit:
- beta isoform
- Partner Proteins:
- FZD8, RYK, FZD8, FZD9, LRP5, LRP6, PORCN, RYK, SFRP1, SFRP2, WNT3A, FZD8, LRP6, SFRP1
- Immunogen:
- The immunogen for anti-PIK3CB antibody: synthetic peptide directed towards the C terminal of human PIK3CB
- Product Format:
- Lyophilized powder
- Purification:
- Protein A purified
- Complete computational species homology data:
- PIK3CB antibody - C-terminal region (ARP32117_T100)
- Predicted Homology Based on Immunogen Sequence:
- Bovine: 100%; Chicken: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
- Datasheets / Downloads:
- Printable datasheet for
anti-PIK3CB antibody
- ARP32117_T100 - Peptide Sequence:
- Synthetic peptide located within the following region: VKDIQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKD
- Blocking Peptide:
- For anti-PIK3CB antibody is Catalog # AAP32117 (Previous Catalog # AAPP03034)
- Key Reference:
- Zhao,J.J., et al., (2005) Proc. Natl. Acad. Sci. U.S.A. 102 (51), 18443-18448
- Reconstitution and Storage:
- Add 100 μl of distilled water. Final anti-PIK3CB antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: PIK3CB antibody tested with Human Fetal Brain Tissue (ARP32117_T100)
Aviva Systems Biology is the original manufacturer of this PIK3CB antibody (ARP32117_T100)
Click here to view the PIK3CB antibody Western Blot Protocol
Product Datasheet Link: PIK3CB antibody (ARP32117_T100)
WB Suggested Anti-PIK3CB Antibody Titration: 5ug/ml
Positive Control: Fetal brain
Western Blot image: 
Description of Target: Phosphoinositide 3-kinases (PI3Ks) phosphorylate the 3-prime OH position of the inositol ring of inositol lipids. They have been implicated as participants in signaling pathways regulating cell growth by virtue of their activation in response to various mitogenic stimuli. PI3Ks are composed of a 110-kD catalytic subunit, such as PIK3CB, and an 85-kD adaptor subunit (Hu et al., 1993).[supplied by OMIM].
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s PIK3CB antibody (ARP32117_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
- Protocol:
- Tips Information:
See our General FAQ page.


