website statistics

Aviva Systems Biology

Account Login 

Aviva Systems Biology office will be closed on Memorial Day - 5/27/2013.
Please go here for more info.

Now Offering Over 48,216 Antibodies & 21,887 Antigens!

Print Page
50ug
$289.00
In Stock

E2F2 antibody - middle region (ARP38418_P050)

Description of Target:
E2F2 is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F1 and E2F3, have an additional cyclin binding domain. This protein binds specifically to retinoblastoma protein pRB in a cell-cycle dependent manner, and it exhibits overall 46% amino acid identity to E2F1.The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F1 and E2F3, have an additional cyclin binding domain. This protein binds specifically to retinoblastoma protein pRB in a cell-cycle dependent manner, and it exhibits overall 46% amino acid identity to E2F1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Gene Symbol:
E2F2
Official Gene Full Name:
E2F transcription factor 2
Alias Symbols:
E2F-2
Tissue Tool:
Find tissues and cell lines supported to express E2F2.
Protein Accession# :
NP_004082
Nucleotide Accession#:
NM_004091
Swissprot Id:
Q14209
Host:
Rabbit
Clonality:
Polyclonal
Protein Size (# AA):
437
Molecular Weight:
47kDa
Application:
WB, IHC
Partner Proteins:
ATXN1, CREBBP, ESR1, ESR2, ID3, LMNA, MAPK1, MAPK3, NR0B1, SMARCD3, SP1, SREBF1, SUMO1, TWIST2, UBE2I, YY1, CREBBP, GAL11, LMNA, MAPK1, MAPK3, NR0B1, SP1, TWIST2, UBE2I, YY1
Immunogen:
The immunogen for anti-E2F2 antibody: synthetic peptide directed towards the middle region of human E2F2
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
E2F2 antibody - middle region (ARP38418_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Bovine: 91%; Guinea pig: 78%
Datasheets / Downloads:
Printable datasheet for
anti-E2F2 antibody
- ARP38418_P050
Peptide Sequence:
Synthetic peptide located within the following region: DQFLSPTLACSSPLISFSPSLDQDDYLWGLEAGEGISDLFDSYDLGDLLI
Blocking Peptide:
For anti-E2F2 antibody is Catalog # AAP38418 (Previous Catalog # AAPP20608)
Key Reference:
Raj,D., (2008) Carcinogenesis 29 (1), 194-201
Reconstitution and Storage:
Add 50 μl of distilled water. Final anti-E2F2 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: E2F2 antibody tested with Human Fetal Brain Tissue (ARP38418_P050)

Aviva Systems Biology is the original manufacturer of this E2F2 antibody (ARP38418_P050)

Click here to view the E2F2 antibody Western Blot Protocol

Product Datasheet Link: E2F2 antibody (ARP38418_P050)

WB Suggested Anti-E2F2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Fetal Brain

Western Blot image:


Description of Target: E2F2 is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F1 and E2F3, have an additional cyclin binding domain. This protein binds specifically to retinoblastoma protein pRB in a cell-cycle dependent manner, and it exhibits overall 46% amino acid identity to E2F1.The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F1 and E2F3, have an additional cyclin binding domain. This protein binds specifically to retinoblastoma protein pRB in a cell-cycle dependent manner, and it exhibits overall 46% amino acid identity to E2F1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s E2F2 antibody (ARP38418_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com