SPI1 antibody - middle region (ARP38241_P050)

Catalog#: ARP38241_P050

• Size: 50ug

Human Muscle

• Description of Target: SPI1 is known to collaborate with multiple transcription factors and to regulate expression of immunoglobulin genes. Lack of SPI1 expression is associated with defective immunoglobulin transcription in Hodgkin and Reed-Sternberg cells of classical Hodgkin disease. This gene encodes an ETS-domain transcription factor that activates gene expression during myeloid and B-lymphoid cell development. The nuclear protein binds to a purine-rich sequence known as the PU-box found near the promoters of target genes, and regulates their expression in coordination with other transcription factors and cofactors. The protein can also regulate alternative splicing of target genes. Multiple transcript variants encoding different isoforms have been found for this gene.
• Gene Symbol: SPI1
• Official Gene Full Name: Spleen focus forming virus (SFFV) proviral integration oncogene spi1
• Alias Symbols: OF; PU.1; SFPI1; SPI-1; SPI-A
• Protein Accession#: NP_003111
• Nucleotide Accession#: NM_003120
• Swissprot Id: P17947
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 270
• Molecular Weight: 31kDa
• Application: WB
• Partner Proteins: CEBPB, CREBBP, CSNK2A1, CSNK2A2, IRF4, JUN, MAPK3, MAPK8, RB1, SPI1, SPIB, TBP, CSNK2A1, E2F1, E2F2, E2F3, E2F4, JUN, MAPK3, MAPK8, SPI1, SPIB, TBP
• Immunogen: The immunogen for anti-SPI1 antibody: synthetic peptide directed towards the middle region of human SPI1
• Product Format: Lyophilized powder
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Bovine: 100%; Chicken: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Zebrafish: 100%; Guinea pig: 84%
• Peptide Sequence: Synthetic peptide located within the following region: QKGNRKKMTYQKMARALRNYGKTGEVKKVKKKLTYQFSGEVLGRGGLAER
• Blocking Peptide: For anti-SPI1 antibody is Catalog # AAP38241 (Previous Catalog # AAPS05108)
• Key Reference: Crotti,T.N., (2008) J. Cell. Physiol. 215 (3), 636-644
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-SPI1 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: SPI1 antibody tested with Human Fetal Muscle Tissue (ARP38241_P050)

Aviva Systems Biology is the original manufacturer of this SPI1 antibody (ARP38241_P050)

Click here to view the SPI1 antibody Western Blot Protocol

Product Datasheet Link: SPI1 antibody (ARP38241_P050)

WB Suggested Anti-SPI1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Fetal Muscle

Western Blot image:


Description of Target: SPI1 is known to collaborate with multiple transcription factors and to regulate expression of immunoglobulin genes. Lack of SPI1 expression is associated with defective immunoglobulin transcription in Hodgkin and Reed-Sternberg cells of classical Hodgkin disease. This gene encodes an ETS-domain transcription factor that activates gene expression during myeloid and B-lymphoid cell development. The nuclear protein binds to a purine-rich sequence known as the PU-box found near the promoters of target genes, and regulates their expression in coordination with other transcription factors and cofactors. The protein can also regulate alternative splicing of target genes. Multiple transcript variants encoding different isoforms have been found for this gene.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s SPI1 antibody (ARP38241_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com