website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

RAD51 antibody - N-terminal region (ARP33450_P050)

Receive a free positive control (AHL005) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
RAD51 is a member of the RAD51 protein family. RAD51 family members are highly similar to bacterial RecA and Saccharomyces cerevisiae Rad51, and are known to be involved in the homologous recombination and repair of DNA. This protein can interact with the ssDNA-binding protein RPA and RAD52, and it is thought to play roles in homologous pairing and strand transfer of DNA. This protein is also found to interact with BRCA1 and BRCA2, which may be important for the cellular response to DNA damage. BRCA2 is shown to regulate both the intracellular localization and DNA-binding ability of this protein. Loss of these controls following BRCA2 inactivation may be a key event leading to genomic instability and tumorigenesis. Two alternatively spliced transcript variants of this gene, which encode distinct proteins, have been reported. Transcript variants utilizing alternative polyA signals exist.The protein encoded by this gene is a member of the RAD51 protein family. RAD51 family members are highly similar to bacterial RecA and Saccharomyces cerevisiae Rad51, and are known to be involved in the homologous recombination and repair of DNA. This protein can interact with the ssDNA-binding protein RPA and RAD52, and it is thought to play roles in homologous pairing and strand transfer of DNA. This protein is also found to interact with BRCA1 and BRCA2, which may be important for the cellular response to DNA damage. BRCA2 is shown to regulate both the intracellular localization and DNA-binding ability of this protein. Loss of these controls following BRCA2 inactivation may be a key event leading to genomic instability and tumorigenesis. Two alternatively spliced transcript variants of this gene, which encode distinct proteins, have been reported. Transcript variants utilizing alternative polyA signals exist.
Gene Symbol:
Official Gene Full Name:
RAD51 homolog (S. cerevisiae)
NCBI Gene Id:
Alias Symbols:
BRCC5; HRAD51; HsRad51; HsT16930; RAD51A; RECA
Sample Type Confirmation:

RAD51 is supported by BioGPS gene expression data to be expressed in HEK293T, Jurkat

Tissue Tool:
Find tissues and cell lines supported to express RAD51.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
DNA repair protein RAD51 homolog 1
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen for anti-RAD51 antibody: synthetic peptide directed towards the N terminal of human RAD51
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Affinity Purified
Complete computational species homology data:
RAD51 antibody - N-terminal region (ARP33450_P050)
Predicted Homology Based on Immunogen Sequence:
Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Zebrafish: 93%; Yeast: 79%; Goat: 77%
Species Reactivity:
Mouse, Pig, Human, Rat, Horse, Rabbit, Guinea pig, Bovine, Zebrafish, Dog, Yeast, Goat
Datasheets / Downloads:
Printable datasheet for
anti-RAD51 antibody
- ARP33450_P050
Peptide Sequence:
Synthetic peptide located within the following region: ANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAKADKILVMAERYGLS
Blocking Peptide:
For anti-RAD51 antibody is Catalog # AAP33450 (Previous Catalog # AAPP04496)
Additional Information:
IHC Information: Adrenal
Target Reference:
Park,J.Y., (2008) Nucleic Acids Res. 36 (10), 3226-3234
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Computational species homology for RAD51 antibody (ARP33450)

Product page for RAD51 antibody (ARP33450)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African clawed frog RA51A antibody; Xenopus laevis RA51A antibody Q91918 92%
African clawed frog RA51B antibody; Xenopus laevis RA51B antibody Q91917 92%
African elephant LOC100662321 antibody; Loxodonta africana LOC100662321 antibody G3T2F7 100%
Albugo laibachii Nc14 AlNc14C271G9961 antibody F0WUE0 85%
Atlantic salmon ra51a antibody; Salmo salar ra51a antibody B5X4V6 92%
Bovine RAD51 antibody; Bos taurus RAD51 antibody Q2KJ94 100%
Caligus clemensi RAD51 antibody C1C0G1 78%
Chicken RAD51 antibody; Gallus gallus RAD51 antibody P37383 92%
Chicken RAD51A antibody; Gallus gallus RAD51A antibody G1K2Z8 92%
Chinese hamster RAD51 antibody; Cricetulus griseus RAD51 antibody P70099 100%
Chinese hamster Rad51 antibody; Cricetulus griseus Rad51 antibody G3HYS4 100%
Common turkey LOC100542527 antibody; Meleagris gallopavo LOC100542527 antibody G5E7T1 92%
Common turkey RAD51 antibody; Meleagris gallopavo RAD51 antibody G1MVI4 92%
Cryptomonas paramecium rad51 antibody F2HIG6 78%
Dog RAD51 antibody; Canis familiaris RAD51 antibody Q8MKI8 92%
Duckbill platypus LOC100081320 antibody; Ornithorhynchus anatinus LOC100081320 antibody F7F7B8 100%
Entamoeba histolytica Rad51 antibody Q86C17 78%
Gray short-tailed opossum RAD51 antibody; Monodelphis domestica RAD51 antibody F6WB93 92%
Gray short-tailed opossum RAD51 antibody; Monodelphis domestica RAD51 antibody F6T3U9 92%
Guinea pig LOC100716391 antibody; Cavia porcellus LOC100716391 antibody H0VQ96 100%
Horse LOC100071340 antibody; Equus caballus LOC100071340 antibody F6SWI3 100%
Human RAD51 antibody; Homo sapiens RAD51 antibody Q06609 100%
Human RAD51 antibody; Homo sapiens RAD51 antibody Q06609-3 100%
Human RAD51 antibody; Homo sapiens RAD51 antibody Q06609-2 100%
Human RAD51 antibody; Homo sapiens RAD51 antibody Q9NZG9 100%
Human RAD51 antibody; Homo sapiens RAD51 antibody Q6ZNA8 100%
Human RAD51 antibody; Homo sapiens RAD51 antibody Q6TAR4 100%
Human RAD51 antibody; Homo sapiens RAD51 antibody Q5U0A5 100%
Human RAD51 antibody; Homo sapiens RAD51 antibody H0YD61 100%
Human RAD51 antibody; Homo sapiens RAD51 antibody F5GZ69 100%
Human RAD51 antibody; Homo sapiens RAD51 antibody E9PNT5 100%
Human RAD51 antibody; Homo sapiens RAD51 antibody E9PJ30 100%
Human RAD51 antibody; Homo sapiens RAD51 antibody E9PI54 100%
Human RAD51 antibody; Homo sapiens RAD51 antibody E9PF20 100%
Human RAD51 antibody; Homo sapiens RAD51 antibody E7ESN2 84%
Lombardy poplar PnRad51 antibody; Populus nigra PnRad51 antibody Q0PCG3 84%
Lowland gorilla RAD51 antibody; Gorilla gorilla gorilla RAD51 antibody G3RED9 100%
Mouse Cpa1 antibody; Mus musculus Cpa1 antibody D6RCK1 100%
Mouse RAD51 antibody; Mus musculus RAD51 antibody Q08297 100%
Mouse Rad51 antibody; Mus musculus Rad51 antibody A3KGI2 100%
Mouse Rad51 antibody; Mus musculus Rad51 antibody A3KGI0 100%
Nile tilapia Rad51 antibody; Oreochromis niloticus Rad51 antibody Q50LF5 92%
Northern white-cheeked gibbon RAD51 antibody; Nomascus leucogenys RAD51 antibody G1QSD0 100%
Northern white-cheeked gibbon RAD51 antibody; Nomascus leucogenys RAD51 antibody G1QSC9 100%
Northern white-cheeked gibbon RAD51 antibody; Nomascus leucogenys RAD51 antibody G1QSC7 100%
Pig RAD51 antibody; Sus scrofa RAD51 antibody F1SSR9 100%
Pig RAD51 antibody; Sus scrofa RAD51 antibody B0M1M6 100%
Rabbit RAD51 antibody; Oryctolagus cuniculus RAD51 antibody O77507 100%
Rat Rad51 antibody; Rattus norvegicus Rad51 antibody B5DF04 100%
Rhesus macaque LOC708461 antibody; Macaca mulatta LOC708461 antibody F7GCI3 100%
Rhesus macaque LOC708461 antibody; Macaca mulatta LOC708461 antibody F6TQG7 100%
Rhesus macaque LOC708461 antibody; Macaca mulatta LOC708461 antibody F6TQF9 100%
Rhesus macaque LOC708461 antibody; Macaca mulatta LOC708461 antibody F6RPG3 100%
Small-eared galago RAD51 antibody; Otolemur garnettii RAD51 antibody H0XW94 100%
Sorghum Sb02g037320 antibody; Sorghum bicolor Sb02g037320 antibody C5XCD8 76%
Sorghum Sb05g024565 antibody; Sorghum bicolor Sb05g024565 antibody C5Y6F4 76%
Sorghum Sb08g001020 antibody; Sorghum bicolor Sb08g001020 antibody C5YQ79 78%
Three-spined stickleback RAD51 antibody; Gasterosteus aculeatus RAD51 antibody G3PF23 92%
Tomato RAD51 antibody; Solanum lycopersicum RAD51 antibody Q40134 84%
Western clawed frog rad51 antibody; Xenopus tropicalis rad51 antibody F6ZKW7 100%
Western clawed frog rad51 antibody; Xenopus tropicalis rad51 antibody A4IH92 100%
White-tufted-ear marmoset LOC100411922 antibody; Callithrix jacchus LOC100411922 antibody F7IGA0 100%
White-tufted-ear marmoset LOC100411922 antibody; Callithrix jacchus LOC100411922 antibody F7IG99 100%
White-tufted-ear marmoset LOC100411922 antibody; Callithrix jacchus LOC100411922 antibody F7IG81 100%
White-tufted-ear marmoset LOC100411922 antibody; Callithrix jacchus LOC100411922 antibody F7IG78 100%
White-tufted-ear marmoset LOC100411922 antibody; Callithrix jacchus LOC100411922 antibody F7IG74 100%
White-tufted-ear marmoset LOC100411922 antibody; Callithrix jacchus LOC100411922 antibody F7IGA3 100%
Zebra finch LOC100219121 antibody; Taeniopygia guttata LOC100219121 antibody H0ZAJ0 92%
Zebrafish rad51 antibody; Danio rerio rad51 antibody Q6P5K8 92%
Zebrafish rad51 antibody; Danio rerio rad51 antibody Q5TYR1 92%

Product Protocols: RAD51 antibody tested with Human Hepg2 Cells (ARP33450_P050)

Aviva Systems Biology is the original manufacturer of this RAD51 antibody (ARP33450_P050)

Click here to view the RAD51 antibody Western Blot Protocol

Product Datasheet Link: RAD51 antibody (ARP33450_P050)

WB Suggested Anti-RAD51 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:2500
Positive Control: HepG2

Western Blot image:

Description of Target: RAD51 is a member of the RAD51 protein family. RAD51 family members are highly similar to bacterial RecA and Saccharomyces cerevisiae Rad51, and are known to be involved in the homologous recombination and repair of DNA. This protein can interact with the ssDNA-binding protein RPA and RAD52, and it is thought to play roles in homologous pairing and strand transfer of DNA. This protein is also found to interact with BRCA1 and BRCA2, which may be important for the cellular response to DNA damage. BRCA2 is shown to regulate both the intracellular localization and DNA-binding ability of this protein. Loss of these controls following BRCA2 inactivation may be a key event leading to genomic instability and tumorigenesis. Two alternatively spliced transcript variants of this gene, which encode distinct proteins, have been reported. Transcript variants utilizing alternative polyA signals exist.The protein encoded by this gene is a member of the RAD51 protein family. RAD51 family members are highly similar to bacterial RecA and Saccharomyces cerevisiae Rad51, and are known to be involved in the homologous recombination and repair of DNA. This protein can interact with the ssDNA-binding protein RPA and RAD52, and it is thought to play roles in homologous pairing and strand transfer of DNA. This protein is also found to interact with BRCA1 and BRCA2, which may be important for the cellular response to DNA damage. BRCA2 is shown to regulate both the intracellular localization and DNA-binding ability of this protein. Loss of these controls following BRCA2 inactivation may be a key event leading to genomic instability and tumorigenesis. Two alternatively spliced transcript variants of this gene, which encode distinct proteins, have been reported. Transcript variants utilizing alternative polyA signals exist.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s RAD51 antibody (ARP33450_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Product Review: RAD51 antibody - N-terminal region (ARP33450_P050) in 293T cell lysate using Western blot

Product page for RAD51 antibody - N-terminal region (ARP33450_P050)

Application: Western blotting
Species+tissue/cell type: Lane 1: 20ug 293T cell lysate
Primary antibody dilution: 1:1000
Secondary antibody: Anti-rabbit-HRP
Secondary antibody dilution: 1:5000

How do Aviva’s reagents play a role in your experimental goals? This antibody is used for western blot analysis and worked very well
How would you rate this antibody on a scale from 1-5 (5=best) and why? 5
Would you use this antibody in future experiments? yes
Have you used another antibody which has worked in your application? yes
Do you believe the information about the reagent on Aviva’s website is correct? yes
If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not? yes
How did you store the antibody after re-suspension? kept it in -20 degree C
Sample Description (please include 1) species type, and 2) cell/tissue type, and 3) how much protein loaded for each lane of your gel): human, 293T cell, 20ug of cellular extract
How many different experimental trials were conducted using the antibody sample? 1
How was this sample prepared? 293T cells are lysed by RIPA buffer and 20 ug of cellular extract was loaded on 8% SDS-PAGE gel.
proteins are transferred to PVDF membrane.
Primary antibody dilution and incubation time: 5ug of antibody in 5ml antibody dilution buffer. 1 hr incubation.
Secondary antibody used and dilution and incubation time: anti rabbit-HRP conjugate antibody. 1;5000 dilution, 1hr
What controls were used in your experiment (positive/negative)? beta-tubuline for positive and loading control
Please include your detailed WB Procedure/Protocol here: 293Tcells were washed with PBS buffer and lysed with RIPA buffer (1x PBS, 1% IP-40, 0.5% sodium deoxycholate, 0.1% SDS). After 1h incubation on ice, cellular mixture was centrifuged and the supernatant was collected. Equivalent amounts (approximately 20µg) of prepared cellular extracts were separated on a 10% SDS-polyacrylamide gel and transferred to a PVDF membrane (Bio-rad). The membranes were probed with Mus81 antibody followed by anti-rabbit secondary antibodies conjugated with horseradish peroxidase. The signals were detected using ECL-Plus (Amersham). To confirm equal loading, blots were stripped with stripping solution (Chemicon) and reprobed with anti-β-tubulin antibody (Santa Cruz Biotechnology).
Ask a Question