website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!


RAD51 antibody - N-terminal region (ARP33450_P050)

Scroll Horizontally to view all Images
Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
100 ul
    In Stock
    Click here to learn more about Aviva's By-Request Conjugation Service.
    Gene Symbol:
    NCBI Gene Id:
    Official Gene Full Name:
    RAD51 homolog (S. cerevisiae)
    Protein Name:
    DNA repair protein RAD51 homolog 1
    Swissprot Id:
    Protein Accession #:
    Nucleotide Accession #:
    Alias Symbols:
    BRCC5, HRAD51, HsRad51, HsT16930, RAD51A, RECA
    Description of Target:
    RAD51 is a member of the RAD51 protein family. RAD51 family members are highly similar to bacterial RecA and Saccharomyces cerevisiae Rad51, and are known to be involved in the homologous recombination and repair of DNA. This protein can interact with the ssDNA-binding protein RPA and RAD52, and it is thought to play roles in homologous pairing and strand transfer of DNA. This protein is also found to interact with BRCA1 and BRCA2, which may be important for the cellular response to DNA damage. BRCA2 is shown to regulate both the intracellular localization and DNA-binding ability of this protein. Loss of these controls following BRCA2 inactivation may be a key event leading to genomic instability and tumorigenesis. Two alternatively spliced transcript variants of this gene, which encode distinct proteins, have been reported. Transcript variants utilizing alternative polyA signals exist.The protein encoded by this gene is a member of the RAD51 protein family. RAD51 family members are highly similar to bacterial RecA and Saccharomyces cerevisiae Rad51, and are known to be involved in the homologous recombination and repair of DNA. This protein can interact with the ssDNA-binding protein RPA and RAD52, and it is thought to play roles in homologous pairing and strand transfer of DNA. This protein is also found to interact with BRCA1 and BRCA2, which may be important for the cellular response to DNA damage. BRCA2 is shown to regulate both the intracellular localization and DNA-binding ability of this protein. Loss of these controls following BRCA2 inactivation may be a key event leading to genomic instability and tumorigenesis. Two alternatively spliced transcript variants of this gene, which encode distinct proteins, have been reported. Transcript variants utilizing alternative polyA signals exist.
    Protein Size (# AA):
    Molecular Weight:
    Affinity Purified
    IHC, WB
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express RAD51.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express RAD51.
    The immunogen is a synthetic peptide directed towards the N terminal region of human RAD51
    Species Reactivity:
    Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
    Predicted Homology Based on Immunogen Sequence:
    Cow: 100%; Dog: 93%; Goat: 77%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 79%; Zebrafish: 93%
    Complete computational species homology data:
    Anti-RAD51 (ARP33450_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: ANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAKADKILVMAERYGLS
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    Blocking Peptide:
    For anti-RAD51 (ARP33450_P050) antibody is Catalog # AAP33450 (Previous Catalog # AAPP04496)
    Datasheets / Downloads:
    Printable datasheet for anti-RAD51 (ARP33450_P050) antibody
    Sample Type Confirmation:

    RAD51 is supported by BioGPS gene expression data to be expressed in HEK293T, Jurkat

    Additional Information:
    IHC Information: Adrenal
    Target Reference:
    Park,J.Y., (2008) Nucleic Acids Res. 36 (10), 3226-3234

    Product Protocols: RAD51 antibody tested with Human Hepg2 Cells (ARP33450_P050)

    Aviva Systems Biology is the original manufacturer of this RAD51 antibody (ARP33450_P050)

    Click here to view the RAD51 antibody Western Blot Protocol

    Product Datasheet Link: RAD51 antibody (ARP33450_P050)

    WB Suggested Anti-RAD51 Antibody Titration: 0.2-1 ug/ml
    ELISA Titer: 1:2500
    Positive Control: HepG2

    Western Blot image:

    Description of Target: RAD51 is a member of the RAD51 protein family. RAD51 family members are highly similar to bacterial RecA and Saccharomyces cerevisiae Rad51, and are known to be involved in the homologous recombination and repair of DNA. This protein can interact with the ssDNA-binding protein RPA and RAD52, and it is thought to play roles in homologous pairing and strand transfer of DNA. This protein is also found to interact with BRCA1 and BRCA2, which may be important for the cellular response to DNA damage. BRCA2 is shown to regulate both the intracellular localization and DNA-binding ability of this protein. Loss of these controls following BRCA2 inactivation may be a key event leading to genomic instability and tumorigenesis. Two alternatively spliced transcript variants of this gene, which encode distinct proteins, have been reported. Transcript variants utilizing alternative polyA signals exist.The protein encoded by this gene is a member of the RAD51 protein family. RAD51 family members are highly similar to bacterial RecA and Saccharomyces cerevisiae Rad51, and are known to be involved in the homologous recombination and repair of DNA. This protein can interact with the ssDNA-binding protein RPA and RAD52, and it is thought to play roles in homologous pairing and strand transfer of DNA. This protein is also found to interact with BRCA1 and BRCA2, which may be important for the cellular response to DNA damage. BRCA2 is shown to regulate both the intracellular localization and DNA-binding ability of this protein. Loss of these controls following BRCA2 inactivation may be a key event leading to genomic instability and tumorigenesis. Two alternatively spliced transcript variants of this gene, which encode distinct proteins, have been reported. Transcript variants utilizing alternative polyA signals exist.

    Questions pertaining to this data can be directed to

    Aviva Systems Biology’s RAD51 antibody (ARP33450_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

    To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

    All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

    Product Review: RAD51 antibody - N-terminal region (ARP33450_P050) in 293T cell lysate using Western blot

    Product page for RAD51 antibody - N-terminal region (ARP33450_P050)

    Application: Western blotting
    Species+tissue/cell type: Lane 1: 20ug 293T cell lysate
    Primary antibody dilution: 1:1000
    Secondary antibody: Anti-rabbit-HRP
    Secondary antibody dilution: 1:5000

    How do Aviva’s reagents play a role in your experimental goals? This antibody is used for western blot analysis and worked very well
    How would you rate this antibody on a scale from 1-5 (5=best) and why? 5
    Would you use this antibody in future experiments? yes
    Have you used another antibody which has worked in your application? yes
    Do you believe the information about the reagent on Aviva’s website is correct? yes
    If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not? yes
    How did you store the antibody after re-suspension? kept it in -20 degree C
    Sample Description (please include 1) species type, and 2) cell/tissue type, and 3) how much protein loaded for each lane of your gel): human, 293T cell, 20ug of cellular extract
    How many different experimental trials were conducted using the antibody sample? 1
    How was this sample prepared? 293T cells are lysed by RIPA buffer and 20 ug of cellular extract was loaded on 8% SDS-PAGE gel.
    proteins are transferred to PVDF membrane.
    Primary antibody dilution and incubation time: 5ug of antibody in 5ml antibody dilution buffer. 1 hr incubation.
    Secondary antibody used and dilution and incubation time: anti rabbit-HRP conjugate antibody. 1;5000 dilution, 1hr
    What controls were used in your experiment (positive/negative)? beta-tubuline for positive and loading control
    Please include your detailed WB Procedure/Protocol here: 293Tcells were washed with PBS buffer and lysed with RIPA buffer (1x PBS, 1% IP-40, 0.5% sodium deoxycholate, 0.1% SDS). After 1h incubation on ice, cellular mixture was centrifuged and the supernatant was collected. Equivalent amounts (approximately 20ug) of prepared cellular extracts were separated on a 10% SDS-polyacrylamide gel and transferred to a PVDF membrane (Bio-rad). The membranes were probed with Mus81 antibody followed by anti-rabbit secondary antibodies conjugated with horseradish peroxidase. The signals were detected using ECL-Plus (Amersham). To confirm equal loading, blots were stripped with stripping solution (Chemicon) and reprobed with anti-β-tubulin antibody (Santa Cruz Biotechnology).
    Ask a Question