website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

RAD51 antibody - N-terminal region (ARP33450_P050)

Receive a free positive control (AHL005) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
RAD51 is a member of the RAD51 protein family. RAD51 family members are highly similar to bacterial RecA and Saccharomyces cerevisiae Rad51, and are known to be involved in the homologous recombination and repair of DNA. This protein can interact with the ssDNA-binding protein RPA and RAD52, and it is thought to play roles in homologous pairing and strand transfer of DNA. This protein is also found to interact with BRCA1 and BRCA2, which may be important for the cellular response to DNA damage. BRCA2 is shown to regulate both the intracellular localization and DNA-binding ability of this protein. Loss of these controls following BRCA2 inactivation may be a key event leading to genomic instability and tumorigenesis. Two alternatively spliced transcript variants of this gene, which encode distinct proteins, have been reported. Transcript variants utilizing alternative polyA signals exist.The protein encoded by this gene is a member of the RAD51 protein family. RAD51 family members are highly similar to bacterial RecA and Saccharomyces cerevisiae Rad51, and are known to be involved in the homologous recombination and repair of DNA. This protein can interact with the ssDNA-binding protein RPA and RAD52, and it is thought to play roles in homologous pairing and strand transfer of DNA. This protein is also found to interact with BRCA1 and BRCA2, which may be important for the cellular response to DNA damage. BRCA2 is shown to regulate both the intracellular localization and DNA-binding ability of this protein. Loss of these controls following BRCA2 inactivation may be a key event leading to genomic instability and tumorigenesis. Two alternatively spliced transcript variants of this gene, which encode distinct proteins, have been reported. Transcript variants utilizing alternative polyA signals exist.
Gene Symbol:
RAD51
Official Gene Full Name:
RAD51 homolog (S. cerevisiae)
NCBI Gene Id:
5888
Alias Symbols:
BRCC5; HRAD51; HsRad51; HsT16930; RAD51A; RECA
Sample Type Confirmation:

RAD51 is supported by BioGPS gene expression data to be expressed in HEK293T, Jurkat

Tissue Tool:
Find tissues and cell lines supported to express RAD51.
Protein Accession #:
NP_597994
Nucleotide Accession#:
NM_133487
Swissprot Id:
Q06609-2
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
DNA repair protein RAD51 homolog 1
Protein Size (# AA):
242
Molecular Weight:
26kDa
Application:
IHC, WB
Partner Proteins:
BAK1, BCL6, APEX1, ATF3, ATM, ATM, ATM, ATM, ATR, AURKA, BAK1, BARD1, BAX, BAX, BAX, BCL2L1, BLM, BLM, BLM, BNIP3L, BRCA1, BRCA1, CARM1, CDC25C, CDKN1A, CDKN1A, CDKN1A, CDKN1A, CDKN1A, CR2, CREBBP, CUL9, DDX5, DHCR24, EP300, EP300, EP300, ERCC3, ESR1, FOXO3, GPS2, GSK3B, HCVgp1, HCVgp1, HCVgp1, HCVg
Immunogen:
The immunogen for anti-RAD51 antibody: synthetic peptide directed towards the N terminal of human RAD51
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
RAD51 antibody - N-terminal region (ARP33450_P050)
Predicted Homology Based on Immunogen Sequence:
Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Zebrafish: 93%; Yeast: 79%; Goat: 77%
Species Reactivity:
Mouse, Pig, Human, Rat, Horse, Rabbit, Guinea pig, Bovine, Zebrafish, Dog, Yeast, Goat
Datasheets / Downloads:
Printable datasheet for
anti-RAD51 antibody
- ARP33450_P050
Peptide Sequence:
Synthetic peptide located within the following region: ANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAKADKILVMAERYGLS
Blocking Peptide:
For anti-RAD51 antibody is Catalog # AAP33450 (Previous Catalog # AAPP04496)
Additional Information:
IHC Information: Adrenal
Key Reference:
Park,J.Y., (2008) Nucleic Acids Res. 36 (10), 3226-3234
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-RAD51 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question