website statistics

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

PIAS3 antibody - middle region (ARP32763_P050)

  • Catalog#: ARP32763_P050
  • Domestic: within 1-2 days delivery International: 1-2 days

    *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges

    - Trial Size Available. Trial size is not available for conjugation.
Scroll Horizontally to view all Images
Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
100 ul
    $289.00
    In Stock
    Click here to learn more about Aviva's By-Request Conjugation Service.
    Gene Symbol:
    PIAS3
    NCBI Gene Id:
    10401
    Official Gene Full Name:
    Protein inhibitor of activated STAT, 3
    Protein Name:
    E3 SUMO-protein ligase PIAS3
    Swissprot Id:
    Q9Y6X2
    Protein Accession #:
    NP_006090
    Nucleotide Accession #:
    NM_006099
    Alias Symbols:
    FLJ14651, ZMIZ5
    Description of Target:
    PIAS3 is a member of the protein inhibitor of activated STAT (PIAS) family. It also activates TGF-beta/SMAD transcriptional responses. This gene encodes a member of the PIAS [protein inhibitor of activated STAT (signal transducer and activator of transcription)] family of transcriptional modulators. The protein functions as a SUMO (small ubiquitin-like modifier)-E3 ligase which catalyzes the covalent attachment of a SUMO protein to specific target substrates. It directly binds to several transcription factors and either blocks or enhances their activity. Alternatively spliced transcript variants of this gene have been identified, but the full-length nature of some of these variants has not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
    Protein Size (# AA):
    628
    Molecular Weight:
    68kDa
    Host:
    Rabbit
    Clonality:
    Polyclonal
    Purification:
    Affinity Purified
    Application:
    WB
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express PIAS3.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express PIAS3.
    Immunogen:
    The immunogen is a synthetic peptide directed towards the middle region of human PIAS3
    Species Reactivity:
    Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat
    Predicted Homology Based on Immunogen Sequence:
    Cow: 79%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Rabbit: 79%; Rat: 79%
    Complete computational species homology data:
    Anti-PIAS3 (ARP32763_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: DEIQFMEDGSWCPMKPKKEASEVCPPPGYGLDGLQYSPVQGGDPSENKKK
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Concentration:
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    UBC; HIC1; TRIM63; TRIM55; TAB2; SUMO1; CBS; SUMO2; SUMO3; STAT3; NCOA2; CREM; PRPF40A; SERPINA10; GEMIN4; UBE2I; SKIL; HNRNPK; ZFHX3; SERBP1; SATB1; ERBB4; Bcl11a; ELAVL1; PPP1CA; Grm7; Grm8; Grm6; Grm4; TRIM8; RAC1; C19orf60; CARHSP1; UBA1; PSMC1; TRIM2
    Blocking Peptide:
    For anti-PIAS3 (ARP32763_P050) antibody is Catalog # AAP32763 (Previous Catalog # AAPP03778)
    Datasheets / Downloads:
    Printable datasheet for anti-PIAS3 (ARP32763_P050) antibody
    Target Reference:
    Roukens,M.G., (2008) Mol. Cell. Biol. 28 (7), 2342-2357

    Product Protocols: PIAS3 antibody tested with Human Fetal Spleen Tissue (ARP32763_P050)

    Aviva Systems Biology is the original manufacturer of this PIAS3 antibody (ARP32763_P050)

    Click here to view the PIAS3 antibody Western Blot Protocol

    Product Datasheet Link: PIAS3 antibody (ARP32763_P050)

    WB Suggested Anti-PIAS3 Antibody Titration: 0.2-1 ug/ml
    ELISA Titer: 1:62500
    Positive Control: Fetal Spleen

    Western Blot image:


    Description of Target: PIAS3 is a member of the protein inhibitor of activated STAT (PIAS) family. It also activates TGF-beta/SMAD transcriptional responses. This gene encodes a member of the PIAS [protein inhibitor of activated STAT (signal transducer and activator of transcription)] family of transcriptional modulators. The protein functions as a SUMO (small ubiquitin-like modifier)-E3 ligase which catalyzes the covalent attachment of a SUMO protein to specific target substrates. It directly binds to several transcription factors and either blocks or enhances their activity. Alternatively spliced transcript variants of this gene have been identified, but the full-length nature of some of these variants has not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

    Questions pertaining to this data can be directed to techsupport@avivasysbio.com

    Aviva Systems Biology’s PIAS3 antibody (ARP32763_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

    To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

    All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

     
    X
    Ask a Question