website statistics

Aviva Systems Biology office will be closed for Independence Day - July 4th, 2017.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

PIAS3 antibody - middle region (ARP32763_P050)

Scroll Horizontally to view all Images
Print Page
  • Let us Help: Ask a Question
100 ul
In Stock

Conjugation Options

ARP32763_P050-FITC Conjugated

ARP32763_P050-HRP Conjugated

ARP32763_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Protein inhibitor of activated STAT, 3
Protein Name:
E3 SUMO-protein ligase PIAS3
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
FLJ14651, ZMIZ5
Replacement Item:
This antibody may replace item sc-14017 from Santa Cruz Biotechnology.
Description of Target:
PIAS3 is a member of the protein inhibitor of activated STAT (PIAS) family. It also activates TGF-beta/SMAD transcriptional responses. This gene encodes a member of the PIAS [protein inhibitor of activated STAT (signal transducer and activator of transcription)] family of transcriptional modulators. The protein functions as a SUMO (small ubiquitin-like modifier)-E3 ligase which catalyzes the covalent attachment of a SUMO protein to specific target substrates. It directly binds to several transcription factors and either blocks or enhances their activity. Alternatively spliced transcript variants of this gene have been identified, but the full-length nature of some of these variants has not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PIAS3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PIAS3.
The immunogen is a synthetic peptide directed towards the middle region of human PIAS3
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 79%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Rabbit: 79%; Rat: 79%
Complete computational species homology data:
Anti-PIAS3 (ARP32763_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DEIQFMEDGSWCPMKPKKEASEVCPPPGYGLDGLQYSPVQGGDPSENKKK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-PIAS3 (ARP32763_P050) antibody is Catalog # AAP32763 (Previous Catalog # AAPP03778)
Datasheets / Downloads:
Printable datasheet for anti-PIAS3 (ARP32763_P050) antibody
Target Reference:
Roukens,M.G., (2008) Mol. Cell. Biol. 28 (7), 2342-2357

Product Protocols: PIAS3 antibody tested with Human Fetal Spleen Tissue (ARP32763_P050)

Aviva Systems Biology is the original manufacturer of this PIAS3 antibody (ARP32763_P050)

Click here to view the PIAS3 antibody Western Blot Protocol

Product Datasheet Link: PIAS3 antibody (ARP32763_P050)

WB Suggested Anti-PIAS3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Fetal Spleen

Western Blot image:

Description of Target: PIAS3 is a member of the protein inhibitor of activated STAT (PIAS) family. It also activates TGF-beta/SMAD transcriptional responses. This gene encodes a member of the PIAS [protein inhibitor of activated STAT (signal transducer and activator of transcription)] family of transcriptional modulators. The protein functions as a SUMO (small ubiquitin-like modifier)-E3 ligase which catalyzes the covalent attachment of a SUMO protein to specific target substrates. It directly binds to several transcription factors and either blocks or enhances their activity. Alternatively spliced transcript variants of this gene have been identified, but the full-length nature of some of these variants has not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s PIAS3 antibody (ARP32763_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...