website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

PIAS3 antibody - middle region (ARP32763_P050)

Description of Target:
PIAS3 is a member of the protein inhibitor of activated STAT (PIAS) family. It also activates TGF-beta/SMAD transcriptional responses. This gene encodes a member of the PIAS [protein inhibitor of activated STAT (signal transducer and activator of transcription)] family of transcriptional modulators. The protein functions as a SUMO (small ubiquitin-like modifier)-E3 ligase which catalyzes the covalent attachment of a SUMO protein to specific target substrates. It directly binds to several transcription factors and either blocks or enhances their activity. Alternatively spliced transcript variants of this gene have been identified, but the full-length nature of some of these variants has not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Gene Symbol:
PIAS3
Official Gene Full Name:
Protein inhibitor of activated STAT, 3
NCBI Gene Id:
10401
Alias Symbols:
FLJ14651; ZMIZ5
Tissue Tool:
Find tissues and cell lines supported to express PIAS3.
Protein Accession #:
NP_006090
Nucleotide Accession#:
NM_006099
Swissprot Id:
Q9Y6X2
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
E3 SUMO-protein ligase PIAS3
Protein Size (# AA):
628
Molecular Weight:
68kDa
Application:
WB
Partner Proteins:
ESR1, NCOA2
Immunogen:
The immunogen for anti-PIAS3 antibody: synthetic peptide directed towards the middle region of human PIAS3
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
PIAS3 antibody - middle region (ARP32763_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Dog: 86%; Pig: 86%; Horse: 86%; Guinea pig: 86%; Rat: 79%; Bovine: 79%; Rabbit: 79%
Species Reactivity:
Human, Dog, Horse, Guinea pig, Bovine, Rabbit, Rat
Datasheets / Downloads:
Printable datasheet for
anti-PIAS3 antibody
- ARP32763_P050
Peptide Sequence:
Synthetic peptide located within the following region: DEIQFMEDGSWCPMKPKKEASEVCPPPGYGLDGLQYSPVQGGDPSENKKK
Blocking Peptide:
For anti-PIAS3 antibody is Catalog # AAP32763 (Previous Catalog # AAPP03778)
Key Reference:
Roukens,M.G., (2008) Mol. Cell. Biol. 28 (7), 2342-2357
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-PIAS3 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question