website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

PIAS3 antibody - middle region (ARP32763_P050)

Description of Target:
PIAS3 is a member of the protein inhibitor of activated STAT (PIAS) family. It also activates TGF-beta/SMAD transcriptional responses. This gene encodes a member of the PIAS [protein inhibitor of activated STAT (signal transducer and activator of transcription)] family of transcriptional modulators. The protein functions as a SUMO (small ubiquitin-like modifier)-E3 ligase which catalyzes the covalent attachment of a SUMO protein to specific target substrates. It directly binds to several transcription factors and either blocks or enhances their activity. Alternatively spliced transcript variants of this gene have been identified, but the full-length nature of some of these variants has not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Gene Symbol:
Official Gene Full Name:
Protein inhibitor of activated STAT, 3
NCBI Gene Id:
Alias Symbols:
FLJ14651; ZMIZ5
Tissue Tool:
Find tissues and cell lines supported to express PIAS3.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
E3 SUMO-protein ligase PIAS3
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
The immunogen for anti-PIAS3 antibody: synthetic peptide directed towards the middle region of human PIAS3
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Affinity Purified
Complete computational species homology data:
PIAS3 antibody - middle region (ARP32763_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Dog: 86%; Pig: 86%; Horse: 86%; Guinea pig: 86%; Rat: 79%; Bovine: 79%; Rabbit: 79%
Species Reactivity:
Human, Dog, Horse, Guinea pig, Bovine, Rabbit, Rat
Datasheets / Downloads:
Printable datasheet for
anti-PIAS3 antibody
- ARP32763_P050
Peptide Sequence:
Synthetic peptide located within the following region: DEIQFMEDGSWCPMKPKKEASEVCPPPGYGLDGLQYSPVQGGDPSENKKK
Blocking Peptide:
For anti-PIAS3 antibody is Catalog # AAP32763 (Previous Catalog # AAPP03778)
Target Reference:
Roukens,M.G., (2008) Mol. Cell. Biol. 28 (7), 2342-2357
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Computational species homology for PIAS3 antibody (ARP32763)

Product page for PIAS3 antibody (ARP32763)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant PIAS3 antibody; Loxodonta africana PIAS3 antibody G3T1L5 78%
Bovine PIAS3 antibody; Bos taurus PIAS3 antibody A6QQU9 78%
Dog PIAS3 antibody; Canis familiaris PIAS3 antibody F1Q1E9 85%
Dog PIAS3 antibody; Canis familiaris PIAS3 antibody E2R2U8 85%
Guinea pig PIAS3 antibody; Cavia porcellus PIAS3 antibody H0UZB7 85%
Horse PIAS3 antibody; Equus caballus PIAS3 antibody F6RAQ9 85%
Human DKFZp727A051 antibody; Homo sapiens DKFZp727A051 antibody A4CZ08 100%
Human PIAS3 antibody; Homo sapiens PIAS3 antibody Q9Y6X2 100%
Human PIAS3 antibody; Homo sapiens PIAS3 antibody Q6IAR4 100%
Human PIAS3 antibody; Homo sapiens PIAS3 antibody E9PHH8 100%
Human PIAS3 antibody; Homo sapiens PIAS3 antibody B3KNI3 100%
Lowland gorilla PIAS3 antibody; Gorilla gorilla gorilla PIAS3 antibody G3QWF6 85%
Rabbit PIAS3 antibody; Oryctolagus cuniculus PIAS3 antibody G1TIE4 78%
Rat PIAS3 antibody; Rattus norvegicus PIAS3 antibody O70260 78%
Rat Pias3 antibody; Rattus norvegicus Pias3 antibody D3ZW81 78%
Rhesus macaque Mmu.4521 antibody; Macaca mulatta Mmu.4521 antibody F6V666 85%
Small-eared galago PIAS3 antibody; Otolemur garnettii PIAS3 antibody H0WFY3 85%
White-tufted-ear marmoset PIAS3 antibody; Callithrix jacchus PIAS3 antibody F7C6Y1 85%

Product Protocols: PIAS3 antibody tested with Human Fetal Spleen Tissue (ARP32763_P050)

Aviva Systems Biology is the original manufacturer of this PIAS3 antibody (ARP32763_P050)

Click here to view the PIAS3 antibody Western Blot Protocol

Product Datasheet Link: PIAS3 antibody (ARP32763_P050)

WB Suggested Anti-PIAS3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Fetal Spleen

Western Blot image:

Description of Target: PIAS3 is a member of the protein inhibitor of activated STAT (PIAS) family. It also activates TGF-beta/SMAD transcriptional responses. This gene encodes a member of the PIAS [protein inhibitor of activated STAT (signal transducer and activator of transcription)] family of transcriptional modulators. The protein functions as a SUMO (small ubiquitin-like modifier)-E3 ligase which catalyzes the covalent attachment of a SUMO protein to specific target substrates. It directly binds to several transcription factors and either blocks or enhances their activity. Alternatively spliced transcript variants of this gene have been identified, but the full-length nature of some of these variants has not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s PIAS3 antibody (ARP32763_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question