website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

US

Ncoa4 antibody - N-terminal region (ARP37744_P050)

Scroll Horizontally to view all Images
Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
100 ul
    $289.00
    In Stock
    Click here to learn more about Aviva's By-Request Conjugation Service.
    Gene Symbol:
    Ncoa4
    NCBI Gene Id:
    27057
    Official Gene Full Name:
    Nuclear receptor coactivator 4
    Protein Accession #:
    NP_001029160
    Nucleotide Accession #:
    NM_001033988
    Alias Symbols:
    1110034E15Rik, 4432406M01Rik, AI227008, ARA70, MGC103382, Rfg
    Description of Target:
    The function of Ncoa4 remains unknown.
    Protein Size (# AA):
    625
    Molecular Weight:
    70kDa
    Host:
    Rabbit
    Clonality:
    Polyclonal
    Purification:
    Affinity Purified
    Application:
    WB
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express Ncoa4.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express Ncoa4.
    Immunogen:
    The immunogen is a synthetic peptide corresponding to a region of Mouse
    Species Reactivity:
    Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
    Predicted Homology Based on Immunogen Sequence:
    Cow: 92%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
    Complete computational species homology data:
    Anti-Ncoa4 (ARP37744_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: CLIHQLEYTQNKDLANQVSVCLERLGSLALKPEDSTVLLFEADTSALRQT
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Concentration:
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    Ndn;
    Blocking Peptide:
    For anti-Ncoa4 (ARP37744_P050) antibody is Catalog # AAP37744 (Previous Catalog # AAPP23367)
    Datasheets / Downloads:
    Printable datasheet for anti-Ncoa4 (ARP37744_P050) antibody

    Product Protocols: Ncoa4 antibody tested with Human Mouse Heart Tissue (ARP37744_P050)

    Aviva Systems Biology is the original manufacturer of this Ncoa4 antibody (ARP37744_P050)

    Click here to view the Ncoa4 antibody Western Blot Protocol

    Product Datasheet Link: Ncoa4 antibody (ARP37744_P050)

    WB Suggested Anti-Ncoa4 Antibody Titration: 0.2-1 ug/ml
    ELISA Titer: 1:312500
    Positive Control: Mouse Heart

    Western Blot image:


    Description of Target: The function of Ncoa4 remains unknown.

    Questions pertaining to this data can be directed to techsupport@avivasysbio.com

    Aviva Systems Biology’s Ncoa4 antibody (ARP37744_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

    To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

    All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

     
    X
    Ask a Question