website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

Ncoa4 antibody - N-terminal region (ARP37744_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Description of Target:
The function of Ncoa4 remains unknown.
Gene Symbol:
Official Gene Full Name:
Nuclear receptor coactivator 4
NCBI Gene Id:
Alias Symbols:
1110034E15Rik; 4432406M01Rik; AI227008; ARA70; MGC103382; Rfg
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Ncoa4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Ncoa4.
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen is a synthetic peptide corresponding to a region of Mouse
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Affinity Purified
Complete computational species homology data:
Anti-Ncoa4 (ARP37744_P050)
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Species Reactivity:
Cow; Dog; Guinea Pig; Horse; Human; Mouse; Rabbit; Rat
Datasheets / Downloads:
Printable datasheet for anti-Ncoa4 (ARP37744_P050) antibody
Peptide Sequence:
Synthetic peptide located within the following region: CLIHQLEYTQNKDLANQVSVCLERLGSLALKPEDSTVLLFEADTSALRQT
Blocking Peptide:
For anti-Ncoa4 (ARP37744_P050) antibody is Catalog # AAP37744 (Previous Catalog # AAPP23367)
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: Ncoa4 antibody tested with Human Mouse Heart Tissue (ARP37744_P050)

Aviva Systems Biology is the original manufacturer of this Ncoa4 antibody (ARP37744_P050)

Click here to view the Ncoa4 antibody Western Blot Protocol

Product Datasheet Link: Ncoa4 antibody (ARP37744_P050)

WB Suggested Anti-Ncoa4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Mouse Heart

Western Blot image:

Description of Target: The function of Ncoa4 remains unknown.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s Ncoa4 antibody (ARP37744_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question