website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

Ncoa4 antibody - N-terminal region (ARP37744_P050)

Description of Target:
The function of Ncoa4 remains unknown.
Gene Symbol:
Official Gene Full Name:
Nuclear receptor coactivator 4
NCBI Gene Id:
Alias Symbols:
1110034E15Rik; 4432406M01Rik; AI227008; ARA70; MGC103382; Rfg
Tissue Tool:
Find tissues and cell lines supported to express Ncoa4.
Protein Accession #:
Nucleotide Accession#:
Protein Size (# AA):
Molecular Weight:
The immunogen for anti-Ncoa4 antibody: synthetic peptide corresponding to a region of Mouse
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Affinity Purified
Complete computational species homology data:
Ncoa4 antibody - N-terminal region (ARP37744_P050)
Predicted Homology Based on Immunogen Sequence:
Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Bovine: 92%
Species Reactivity:
Rat, Human, Mouse, Rabbit, Guinea pig, Dog, Horse, Bovine
Datasheets / Downloads:
Printable datasheet for
anti-Ncoa4 antibody
- ARP37744_P050
Peptide Sequence:
Synthetic peptide located within the following region: CLIHQLEYTQNKDLANQVSVCLERLGSLALKPEDSTVLLFEADTSALRQT
Blocking Peptide:
For anti-Ncoa4 antibody is Catalog # AAP37744 (Previous Catalog # AAPP23367)
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Computational species homology for Ncoa4 antibody (ARP37744)

Product page for Ncoa4 antibody (ARP37744)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant NCOA4 antibody; Loxodonta africana NCOA4 antibody G3SMI2 100%
Bovine NCOA4 antibody; Bos taurus NCOA4 antibody Q1RMQ8 92%
Chicken NCOA4 antibody; Gallus gallus NCOA4 antibody Q5ZMB1 78%
Common turkey LOC100543566 antibody; Meleagris gallopavo LOC100543566 antibody G3UTQ8 78%
Common turkey NCOA4 antibody; Meleagris gallopavo NCOA4 antibody G1MTZ3 78%
Dog NCOA4 antibody; Canis familiaris NCOA4 antibody E2RDF1 92%
Duckbill platypus NCOA4 antibody; Ornithorhynchus anatinus NCOA4 antibody F6V8K4 85%
Duckbill platypus NCOA4 antibody; Ornithorhynchus anatinus NCOA4 antibody F6V8J4 85%
Gray short-tailed opossum NCOA4 antibody; Monodelphis domestica NCOA4 antibody F7CYN9 92%
Guinea pig NCOA4 antibody; Cavia porcellus NCOA4 antibody H0VIS1 100%
Horse NCOA4 antibody; Equus caballus NCOA4 antibody F7A8J5 92%
Human NCOA4 antibody; Homo sapiens NCOA4 antibody Q13772 100%
Human NCOA4 antibody; Homo sapiens NCOA4 antibody Q13772-2 100%
Human NCOA4 antibody; Homo sapiens NCOA4 antibody Q96E88 100%
Human NCOA4 antibody; Homo sapiens NCOA4 antibody H0Y5U8 100%
Human NCOA4 antibody; Homo sapiens NCOA4 antibody E9PAV7 100%
Human NCOA4 antibody; Homo sapiens NCOA4 antibody C9J6E0 100%
Human NCOA4 antibody; Homo sapiens NCOA4 antibody B4E260 100%
Human NCOA4 antibody; Homo sapiens NCOA4 antibody B2R5V0 100%
Human NCOA4 antibody; Homo sapiens NCOA4 antibody B1API7 100%
Human NCOA4 antibody; Homo sapiens NCOA4 antibody A8K8W5 100%
Little brown bat NCOA4 antibody; Myotis lucifugus NCOA4 antibody G1NTQ2 100%
Lowland gorilla NCOA4 antibody; Gorilla gorilla gorilla NCOA4 antibody G3SDB1 100%
Lowland gorilla NCOA4 antibody; Gorilla gorilla gorilla NCOA4 antibody G3RJW8 100%
Mouse Ncoa4 antibody; Mus musculus Ncoa4 antibody Q9WV42 100%
Mouse Ncoa4 antibody; Mus musculus Ncoa4 antibody Q9CXF3 100%
Mouse Ncoa4 antibody; Mus musculus Ncoa4 antibody Q8K2F6 100%
Mouse Ncoa4 antibody; Mus musculus Ncoa4 antibody Q8BSH1 100%
Mouse Ncoa4 antibody; Mus musculus Ncoa4 antibody Q5U4H9 100%
Mouse Ncoa4 antibody; Mus musculus Ncoa4 antibody Q3UKL9 100%
Mouse Ncoa4 antibody; Mus musculus Ncoa4 antibody Q3UJ63 100%
Mouse Ncoa4 antibody; Mus musculus Ncoa4 antibody Q3UJ26 100%
Mouse Ncoa4 antibody; Mus musculus Ncoa4 antibody Q3UI10 100%
Mouse Ncoa4 antibody; Mus musculus Ncoa4 antibody E9Q2H3 100%
Mouse Ncoa4 antibody; Mus musculus Ncoa4 antibody E9Q0D2 100%
Northern white-cheeked gibbon NCOA4 antibody; Nomascus leucogenys NCOA4 antibody G1S1N6 100%
Pig NCOA4 antibody; Sus scrofa NCOA4 antibody F1SDW1 92%
Rat Ncoa4 antibody; Rattus norvegicus Ncoa4 antibody B1H215 100%
Rhesus macaque NCOA4 antibody; Macaca mulatta NCOA4 antibody F7E0M5 100%
Rhesus macaque NCOA4 antibody; Macaca mulatta NCOA4 antibody F6WBM5 100%
Rhesus macaque NCOA4 antibody; Macaca mulatta NCOA4 antibody F6WBK7 100%
Sumatran orangutan DKFZp459B2429 antibody; Pongo abelii DKFZp459B2429 antibody Q5RA55 100%
Sumatran orangutan DKFZp469A035 antibody; Pongo abelii DKFZp469A035 antibody Q5RE55 100%
Sumatran orangutan NCOA4 antibody; Pongo abelii NCOA4 antibody Q5R8R2 100%
Tasmanian devil NCOA4 antibody; Sarcophilus harrisii NCOA4 antibody G3VZF1 100%
White-tufted-ear marmoset NCOA4 antibody; Callithrix jacchus NCOA4 antibody F7I6L2 100%
White-tufted-ear marmoset NCOA4 antibody; Callithrix jacchus NCOA4 antibody F7GDC4 100%

Product Protocols: Ncoa4 antibody tested with Human Mouse Heart Tissue (ARP37744_P050)

Aviva Systems Biology is the original manufacturer of this Ncoa4 antibody (ARP37744_P050)

Click here to view the Ncoa4 antibody Western Blot Protocol

Product Datasheet Link: Ncoa4 antibody (ARP37744_P050)

WB Suggested Anti-Ncoa4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Mouse Heart

Western Blot image:

Description of Target: The function of Ncoa4 remains unknown.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s Ncoa4 antibody (ARP37744_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question