website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

Ncoa4 antibody - N-terminal region (ARP37744_P050)

Description of Target:
The function of Ncoa4 remains unknown.
Gene Symbol:
Ncoa4
Official Gene Full Name:
Nuclear receptor coactivator 4
NCBI Gene Id:
27057
Alias Symbols:
1110034E15Rik; 4432406M01Rik; AI227008; ARA70; MGC103382; Rfg
Tissue Tool:
Find tissues and cell lines supported to express Ncoa4.
Protein Accession #:
NP_001029160
Nucleotide Accession#:
NM_001033988
Host:
Rabbit
Clonality:
Polyclonal
Protein Size (# AA):
625
Molecular Weight:
70kDa
Application:
WB
Immunogen:
The immunogen for anti-Ncoa4 antibody: synthetic peptide corresponding to a region of Mouse
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
Ncoa4 antibody - N-terminal region (ARP37744_P050)
Predicted Homology Based on Immunogen Sequence:
Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Bovine: 92%
Species Reactivity:
Rat, Human, Mouse, Rabbit, Guinea pig, Dog, Horse, Bovine
Datasheets / Downloads:
Printable datasheet for
anti-Ncoa4 antibody
- ARP37744_P050
Peptide Sequence:
Synthetic peptide located within the following region: CLIHQLEYTQNKDLANQVSVCLERLGSLALKPEDSTVLLFEADTSALRQT
Blocking Peptide:
For anti-Ncoa4 antibody is Catalog # AAP37744 (Previous Catalog # AAPP23367)
Key Reference:
N/A
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-Ncoa4 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question