website statistics

Aviva Systems Biology office will be closed for Memorial Day - 5/29/2017.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

Ncoa4 antibody - N-terminal region (ARP37744_P050)

Scroll Horizontally to view all Images
Print Page
  • Let us Help: Ask a Question
100 ul
In Stock

Conjugation Options

ARP37744_P050-FITC Conjugated

ARP37744_P050-HRP Conjugated

ARP37744_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Nuclear receptor coactivator 4
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
1110034E15Rik, 4432406M01Rik, AI227008, ARA70, MGC103382, Rfg
Replacement Item:
This antibody may replace item sc-113567 from Santa Cruz Biotechnology.
Description of Target:
The function of Ncoa4 remains unknown.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Ncoa4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Ncoa4.
The immunogen is a synthetic peptide corresponding to a region of Mouse
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-Ncoa4 (ARP37744_P050)
Peptide Sequence:
Synthetic peptide located within the following region: CLIHQLEYTQNKDLANQVSVCLERLGSLALKPEDSTVLLFEADTSALRQT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-Ncoa4 (ARP37744_P050) antibody is Catalog # AAP37744 (Previous Catalog # AAPP23367)
Datasheets / Downloads:
Printable datasheet for anti-Ncoa4 (ARP37744_P050) antibody

Product Protocols: Ncoa4 antibody tested with Human Mouse Heart Tissue (ARP37744_P050)

Aviva Systems Biology is the original manufacturer of this Ncoa4 antibody (ARP37744_P050)

Click here to view the Ncoa4 antibody Western Blot Protocol

Product Datasheet Link: Ncoa4 antibody (ARP37744_P050)

WB Suggested Anti-Ncoa4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Mouse Heart

Western Blot image:

Description of Target: The function of Ncoa4 remains unknown.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s Ncoa4 antibody (ARP37744_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...