EPAS1 antibody - middle region (ARP32253_P050)

Catalog#: ARP32253_P050

• Size: 50ug

Human 293T

• Description of Target: EPAS1 is a transcription factor involved in the induction of oxygen regulated genes. EPAS1 binds to core DNA sequence 5'-[AG]CGTG-3' within the hypoxia response element (HRE) of target gene promoters. EPAS1 regulates the vascular endothelial growth factor (VEGF) expression and seems to be implicated in the development of blood vessels and the tubular system of lung. EPAS1 may also play a role in the formation of the endothelium that gives rise to the blood brain barrier. EPAS1 is a potent activator of the Tie-2 tyrosine kinase expression. The activation seems to require recruitment of transcriptional coactivators such as CREBPB and probably EP300. Interaction of EPAS1 with redox regulatory protein APEX seems to activate CTAD.
• Gene Symbol: EPAS1
• Official Gene Full Name: Endothelial PAS domain protein 1
• Alias Symbols: HIF2A; HLF; MOP2; PASD2; ECYT4; bHLHe73
• Protein Accession#: NP_001421
• Nucleotide Accession#: NM_001430
• Swissprot Id: Q99814
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 870
• Molecular Weight: 90kDa
• Application: WB
• Immunogen: The immunogen for anti-EPAS1 antibody: synthetic peptide directed towards the middle region of human EPAS1
• Product Format: Lyophilized powder
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: African clawed frog: 100%; Bovine: 100%; Chicken: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 92%; Zebrafish: 92%
• Peptide Sequence: Synthetic peptide located within the following region: ESLFKPHLMAMNSIFDSSGKGAVSEKSNFLFTKLKEEPEELAQLAPTPGD
• Blocking Peptide: For anti-EPAS1 antibody is Catalog # AAP32253 (Previous Catalog # AAPP03234)
• Key Reference: Koizume,S., (2008) Biochem. Biophys. Res. Commun. 371 (2), 251-255
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-EPAS1 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: EPAS1 antibody tested with Human 293T Cells (ARP32253_P050)

Aviva Systems Biology is the original manufacturer of this EPAS1 antibody (ARP32253_P050)

Click here to view the EPAS1 antibody Western Blot Protocol

Product Datasheet Link: EPAS1 antibody (ARP32253_P050)

WB Suggested Anti-EPAS1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T

Western Blot image:


Description of Target: EPAS1 is a transcription factor involved in the induction of oxygen regulated genes. EPAS1 binds to core DNA sequence 5'-[AG]CGTG-3' within the hypoxia response element (HRE) of target gene promoters. EPAS1 regulates the vascular endothelial growth factor (VEGF) expression and seems to be implicated in the development of blood vessels and the tubular system of lung. EPAS1 may also play a role in the formation of the endothelium that gives rise to the blood brain barrier. EPAS1 is a potent activator of the Tie-2 tyrosine kinase expression. The activation seems to require recruitment of transcriptional coactivators such as CREBPB and probably EP300. Interaction of EPAS1 with redox regulatory protein APEX seems to activate CTAD.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s EPAS1 antibody (ARP32253_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com