- Description of Target:
- The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. WNT5A is a member of the WNT protein family. It shows 98%, 98% and 87% amino acid identity to the mouse, rat and the xenopus Wnt5A protein, respectively. The experiments performed in Xenopus laevis embryos identified that human frizzled-5 (hFz5) is the receptor for the Wnt5A ligand and the Wnt5A/hFz5 signaling mediates axis induction.The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It encodes a protein which shows 98%, 98% and 87% amino acid identity to the mouse, rat and the xenopus Wnt5A protein, respectively. The experiments performed in Xenopus laevis embryos identified that human frizzled-5 (hFz5) is the receptor for the Wnt5A ligand and the Wnt5A/hFz5 signaling mediates axis induction. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
- Gene Symbol:
- WNT5A
- Official Gene Full Name:
- Wingless-type MMTV integration site family, member 5A
- Alias Symbols:
- hWNT5A
- Tissue Tool:
- Find tissues and cell lines supported to express WNT5A.
- Protein Accession# :
- NP_003383
- Nucleotide Accession#:
- NM_003392
- Swissprot Id:
- P41221
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 380
- Molecular Weight:
- 42kDa
- Application:
- WB, IHC
- Partner Proteins:
- CALM1, CALM3, CALM3, CSNK2A1, CSNK2A2, ID1, ID2, ID3, MDFI, MYF5, TCF3, ELSPBP1, ID1, ID2, ID3, MDFI, TCF3
- Immunogen:
- The immunogen for anti-WNT5A antibody: synthetic peptide directed towards the middle region of human WNT5A
- Product Format:
- Lyophilized powder
- Purification:
- Affinity Purified
- Complete computational species homology data:
- WNT5A antibody - middle region (ARP32128_P050)
- Predicted Homology Based on Immunogen Sequence:
- Bovine: 100%; Dog: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; African clawed frog: 93%; Chicken: 93%
- Datasheets / Downloads:
- Printable datasheet for
anti-WNT5A antibody
- ARP32128_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: GGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRT
- Blocking Peptide:
- For anti-WNT5A antibody is Catalog # AAP32128 (Previous Catalog # AAPP23848)
- Additional Information:
- IHC Information: Human Brain, Cortex: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Human Colon, Myenteric Plexus: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE) - Key Reference:
- Witze,E.S., (2008) Science 320 (5874), 365-369
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-WNT5A antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
