RAD51 antibody - N-terminal region (ARP33450_P050)

Catalog#: ARP33450_P050

• Size: 50ug

Human Jurkat

Human 293T

Human Adrenal

• Description of Target: RAD51 is a member of the RAD51 protein family. RAD51 family members are highly similar to bacterial RecA and Saccharomyces cerevisiae Rad51, and are known to be involved in the homologous recombination and repair of DNA. This protein can interact with the ssDNA-binding protein RPA and RAD52, and it is thought to play roles in homologous pairing and strand transfer of DNA. This protein is also found to interact with BRCA1 and BRCA2, which may be important for the cellular response to DNA damage. BRCA2 is shown to regulate both the intracellular localization and DNA-binding ability of this protein. Loss of these controls following BRCA2 inactivation may be a key event leading to genomic instability and tumorigenesis. Two alternatively spliced transcript variants of this gene, which encode distinct proteins, have been reported. Transcript variants utilizing alternative polyA signals exist.The protein encoded by this gene is a member of the RAD51 protein family. RAD51 family members are highly similar to bacterial RecA and Saccharomyces cerevisiae Rad51, and are known to be involved in the homologous recombination and repair of DNA. This protein can interact with the ssDNA-binding protein RPA and RAD52, and it is thought to play roles in homologous pairing and strand transfer of DNA. This protein is also found to interact with BRCA1 and BRCA2, which may be important for the cellular response to DNA damage. BRCA2 is shown to regulate both the intracellular localization and DNA-binding ability of this protein. Loss of these controls following BRCA2 inactivation may be a key event leading to genomic instability and tumorigenesis. Two alternatively spliced transcript variants of this gene, which encode distinct proteins, have been reported. Transcript variants utilizing alternative polyA signals exist.
• Gene Symbol: RAD51
• Official Gene Full Name: RAD51 homolog (S. cerevisiae)
• Alias Symbols: BRCC5; HRAD51; HsRad51; HsT16930; RAD51A; RECA
• Protein Accession#: NP_597994
• Nucleotide Accession#: NM_133487
• Swissprot Id: Q06609-2
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 242
• Molecular Weight: 26kDa
• Application: WB, IHC
• Partner Proteins: BAK1, BCL6, APEX1, ATF3, ATM, ATM, ATM, ATM, ATR, AURKA, BAK1, BARD1, BAX, BAX, BAX, BCL2L1, BLM, BLM, BLM, BNIP3L, BRCA1, BRCA1, CARM1, CDC25C, CDKN1A, CDKN1A, CDKN1A, CDKN1A, CDKN1A, CR2, CREBBP, CUL9, DDX5, DHCR24, EP300, EP300, EP300, ERCC3, ESR1, FOXO3, GPS2, GSK3B, HCVgp1, HCVgp1, HCVgp1, HCVg
• Immunogen: The immunogen for anti-RAD51 antibody: synthetic peptide directed towards the N terminal of human RAD51
• Product Format: Lyophilized powder
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Bovine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Chicken: 92%; Dog: 92%; Zebrafish: 92%
• Peptide Sequence: Synthetic peptide located within the following region: ANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAKADKILVMAERYGLS
• Blocking Peptide: For anti-RAD51 antibody is Catalog # AAP33450 (Previous Catalog # AAPP04496)
• Additional Information: IHC Information: Adrenal
• Key Reference: Park,J.Y., (2008) Nucleic Acids Res. 36 (10), 3226-3234
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-RAD51 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: RAD51 antibody tested with Human Hepg2 Cells (ARP33450_P050)

Aviva Systems Biology is the original manufacturer of this RAD51 antibody (ARP33450_P050)

Click here to view the RAD51 antibody Western Blot Protocol

Product Datasheet Link: RAD51 antibody (ARP33450_P050)

WB Suggested Anti-RAD51 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:2500
Positive Control: HepG2

Western Blot image:


Description of Target: RAD51 is a member of the RAD51 protein family. RAD51 family members are highly similar to bacterial RecA and Saccharomyces cerevisiae Rad51, and are known to be involved in the homologous recombination and repair of DNA. This protein can interact with the ssDNA-binding protein RPA and RAD52, and it is thought to play roles in homologous pairing and strand transfer of DNA. This protein is also found to interact with BRCA1 and BRCA2, which may be important for the cellular response to DNA damage. BRCA2 is shown to regulate both the intracellular localization and DNA-binding ability of this protein. Loss of these controls following BRCA2 inactivation may be a key event leading to genomic instability and tumorigenesis. Two alternatively spliced transcript variants of this gene, which encode distinct proteins, have been reported. Transcript variants utilizing alternative polyA signals exist.The protein encoded by this gene is a member of the RAD51 protein family. RAD51 family members are highly similar to bacterial RecA and Saccharomyces cerevisiae Rad51, and are known to be involved in the homologous recombination and repair of DNA. This protein can interact with the ssDNA-binding protein RPA and RAD52, and it is thought to play roles in homologous pairing and strand transfer of DNA. This protein is also found to interact with BRCA1 and BRCA2, which may be important for the cellular response to DNA damage. BRCA2 is shown to regulate both the intracellular localization and DNA-binding ability of this protein. Loss of these controls following BRCA2 inactivation may be a key event leading to genomic instability and tumorigenesis. Two alternatively spliced transcript variants of this gene, which encode distinct proteins, have been reported. Transcript variants utilizing alternative polyA signals exist.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s RAD51 antibody (ARP33450_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

Product Review: RAD51 antibody - N-terminal region (ARP33450_P050) in 293T cell lysate using Western blot

Product page for RAD51 antibody - N-terminal region (ARP33450_P050)

Researcher:Anonymous
Application: Western blotting
Species+tissue/cell type: Lane 1: 20ug 293T cell lysate
Primary antibody dilution: 1:1000
Secondary antibody: Anti-rabbit-HRP
Secondary antibody dilution: 1:5000

Questionnaire:
How do Aviva’s reagents play a role in your experimental goals?	This antibody is used for western blot analysis and worked very well
How would you rate this antibody on a scale from 1-5 (5=best) and why?	5
Would you use this antibody in future experiments?	yes
Have you used another antibody which has worked in your application?	yes
Do you believe the information about the reagent on Aviva’s website is correct?	yes
If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not?	yes
How did you store the antibody after re-suspension?	kept it in -20 degree C
Sample Description (please include 1) species type, and 2) cell/tissue type, and 3) how much protein loaded for each lane of your gel):	human, 293T cell, 20ug of cellular extract
How many different experimental trials were conducted using the antibody sample?	1
How was this sample prepared?	293T cells are lysed by RIPA buffer and 20 ug of cellular extract was loaded on 8% SDS-PAGE gel. proteins are transferred to PVDF membrane.
Primary antibody dilution and incubation time:	5ug of antibody in 5ml antibody dilution buffer. 1 hr incubation.
Secondary antibody used and dilution and incubation time:	anti rabbit-HRP conjugate antibody. 1;5000 dilution, 1hr
What controls were used in your experiment (positive/negative)?	beta-tubuline for positive and loading control
Please include your detailed WB Procedure/Protocol here:	293Tcells were washed with PBS buffer and lysed with RIPA buffer (1x PBS, 1% IP-40, 0.5% sodium deoxycholate, 0.1% SDS). After 1h incubation on ice, cellular mixture was centrifuged and the supernatant was collected. Equivalent amounts (approximately 20µg) of prepared cellular extracts were separated on a 10% SDS-polyacrylamide gel and transferred to a PVDF membrane (Bio-rad). The membranes were probed with Mus81 antibody followed by anti-rabbit secondary antibodies conjugated with horseradish peroxidase. The signals were detected using ECL-Plus (Amersham). To confirm equal loading, blots were stripped with stripping solution (Chemicon) and reprobed with anti-β-tubulin antibody (Santa Cruz Biotechnology).