PIAS3 antibody - middle region (ARP32763_P050)

Catalog#: ARP32763_P050

• Size: 50ug

Human Spleen

• Description of Target: PIAS3 is a member of the protein inhibitor of activated STAT (PIAS) family. It also activates TGF-beta/SMAD transcriptional responses. This gene encodes a member of the PIAS [protein inhibitor of activated STAT (signal transducer and activator of transcription)] family of transcriptional modulators. The protein functions as a SUMO (small ubiquitin-like modifier)-E3 ligase which catalyzes the covalent attachment of a SUMO protein to specific target substrates. It directly binds to several transcription factors and either blocks or enhances their activity. Alternatively spliced transcript variants of this gene have been identified, but the full-length nature of some of these variants has not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Gene Symbol: PIAS3
• Official Gene Full Name: Protein inhibitor of activated STAT, 3
• Alias Symbols: FLJ14651; ZMIZ5
• Protein Accession#: NP_006090
• Nucleotide Accession#: NM_006099
• Swissprot Id: Q9Y6X2
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 628
• Molecular Weight: 68kDa
• Application: WB
• Partner Proteins: ESR1, NCOA2
• Immunogen: The immunogen for anti-PIAS3 antibody: synthetic peptide directed towards the middle region of human PIAS3
• Product Format: Lyophilized powder
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Dog: 85%; Guinea pig: 85%; Horse: 85%; Bovine: 78%; Rabbit: 78%; Rat: 78%
• Peptide Sequence: Synthetic peptide located within the following region: DEIQFMEDGSWCPMKPKKEASEVCPPPGYGLDGLQYSPVQGGDPSENKKK
• Blocking Peptide: For anti-PIAS3 antibody is Catalog # AAP32763 (Previous Catalog # AAPP03778)
• Key Reference: Roukens,M.G., (2008) Mol. Cell. Biol. 28 (7), 2342-2357
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-PIAS3 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: PIAS3 antibody tested with Human Fetal Spleen Tissue (ARP32763_P050)

Aviva Systems Biology is the original manufacturer of this PIAS3 antibody (ARP32763_P050)

Click here to view the PIAS3 antibody Western Blot Protocol

Product Datasheet Link: PIAS3 antibody (ARP32763_P050)

WB Suggested Anti-PIAS3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Fetal Spleen

Western Blot image:


Description of Target: PIAS3 is a member of the protein inhibitor of activated STAT (PIAS) family. It also activates TGF-beta/SMAD transcriptional responses. This gene encodes a member of the PIAS [protein inhibitor of activated STAT (signal transducer and activator of transcription)] family of transcriptional modulators. The protein functions as a SUMO (small ubiquitin-like modifier)-E3 ligase which catalyzes the covalent attachment of a SUMO protein to specific target substrates. It directly binds to several transcription factors and either blocks or enhances their activity. Alternatively spliced transcript variants of this gene have been identified, but the full-length nature of some of these variants has not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s PIAS3 antibody (ARP32763_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com