website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!


TRAP1 Antibody - N-terminal region (ARP30183_P050)

Scroll Horizontally to view all Images
Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
100 ul
    In Stock
    Click here to learn more about Aviva's By-Request Conjugation Service.
    Gene Symbol:
    NCBI Gene Id:
    Protein Name:
    Heat shock protein 75 kDa, mitochondrial
    Swissprot Id:
    Protein Accession #:
    Nucleotide Accession #:
    Alias Symbols:
    HSP75, HSP90L
    Description of Target:
    Suppression of the expression of TRAP1 in mitochondria might play an important role in the induction of apoptosis caused via formation of ROS.
    Protein Size (# AA):
    Molecular Weight:
    Affinity Purified
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express TRAP1.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express TRAP1.
    The immunogen is a synthetic peptide directed towards the N-terminal region of Human TRAP1
    Species Reactivity:
    Dog, Guinea Pig, Human, Mouse, Rat
    Predicted Homology Based on Immunogen Sequence:
    Dog: 86%; Guinea Pig: 93%; Human: 100%; Mouse: 86%; Rat: 93%
    Complete computational species homology data:
    Anti-TRAP1 (ARP30183_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: RRTTAQLGPRRNPAWSLQAGRLFSTQTAEDKEEPLHSIISSTESVQGSTS
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    Blocking Peptide:
    For anti-TRAP1 (ARP30183_P050) antibody is Catalog # AAP30183
    Datasheets / Downloads:
    Printable datasheet for anti-TRAP1 (ARP30183_P050) antibody
    Sample Type Confirmation:

    TRAP1 is supported by BioGPS gene expression data to be expressed in HeLa

    Ask a Question