website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$289.00
In Stock

TRAP1 Antibody - N-terminal region (ARP30183_P050)

Receive a free positive control (AHL006) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
Suppression of the expression of TRAP1 in mitochondria might play an important role in the induction of apoptosis caused via formation of ROS.
Gene Symbol:
TRAP1
NCBI Gene Id:
10131
Alias Symbols:
HSP75; HSP90L
Sample Type Confirmation:

TRAP1 is supported by BioGPS gene expression data to be expressed in HeLa

Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TRAP1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TRAP1.
Swissprot Id:
Q12931
Protein Accession #:
NP_057376
Nucleotide Accession #:
NM_016292
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Heat shock protein 75 kDa, mitochondrial
Protein Size (# AA):
704
Molecular Weight:
80kDa
Application:
WB
Protein Interactions:
SUMO2; SUMO3; LGALS3BP; CEP72; CEP250; UBC; MDM2; OGFR; MAGED2; FKBP5; USP7; EIF2AK4; RPS19; RPL7A; HSPA5; GAPDH; EIF4A1; EEF1G; EEF1A1; FBXO6; PRKACB; CDK9; CDK5; CDK4; ESX1; TPM3; FN1; C1QBP; TRAF3IP1; WDHD1; VDAC2; VAMP2; APP; CUL3; CUL5; PSMC4; RAD21;
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human TRAP1
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Purification:
Affinity Purified
Complete computational species homology data:
Anti-TRAP1 (ARP30183_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 86%; Guinea Pig: 93%; Human: 100%; Mouse: 86%; Rat: 93%
Species Reactivity:
Dog; Guinea Pig; Human; Mouse; Rat
Datasheets / Downloads:
Printable datasheet for anti-TRAP1 (ARP30183_P050) antibody
Peptide Sequence:
Synthetic peptide located within the following region: RRTTAQLGPRRNPAWSLQAGRLFSTQTAEDKEEPLHSIISSTESVQGSTS
Blocking Peptide:
For anti-TRAP1 (ARP30183_P050) antibody is Catalog # AAP30183
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
 
X
Ask a Question