website statistics
Account Login 

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

TRAP1 Antibody - N-terminal region (ARP30183_P050)

  • Catalog#: ARP30183_P050
  • Domestic: within 1-2 days delivery International: 1-2 days
    *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges
    - Trial Size Available. Trial size is not available for conjugation.
Scroll Horizontally to view all Images
Print Page
100 ul
    $289.00
    In Stock

    Conjugation Options

    ARP30183_P050-FITC Conjugated

    ARP30183_P050-HRP Conjugated

    ARP30183_P050-Biotin Conjugated

    Gene Symbol:
    TRAP1
    NCBI Gene Id:
    10131
    Protein Name:
    Heat shock protein 75 kDa, mitochondrial
    Swissprot Id:
    Q12931
    Protein Accession #:
    NP_057376
    Nucleotide Accession #:
    NM_016292
    Alias Symbols:
    HSP75, HSP90L
    Replacement Item:
    This antibody may replace item sc-136421 from Santa Cruz Biotechnology.
    Description of Target:
    Suppression of the expression of TRAP1 in mitochondria might play an important role in the induction of apoptosis caused via formation of ROS.
    Protein Size (# AA):
    704
    Molecular Weight:
    80kDa
    Host:
    Rabbit
    Clonality:
    Polyclonal
    Purification:
    Affinity Purified
    Application:
    WB
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express TRAP1.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express TRAP1.
    Immunogen:
    The immunogen is a synthetic peptide directed towards the N-terminal region of Human TRAP1
    Species Reactivity:
    Dog, Guinea Pig, Human, Mouse, Rat
    Predicted Homology Based on Immunogen Sequence:
    Dog: 86%; Guinea Pig: 93%; Human: 100%; Mouse: 86%; Rat: 93%
    Complete computational species homology data:
    Anti-TRAP1 (ARP30183_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: RRTTAQLGPRRNPAWSLQAGRLFSTQTAEDKEEPLHSIISSTESVQGSTS
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Concentration:
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    SUMO2; SUMO3; LGALS3BP; CEP72; CEP250; UBC; MDM2; OGFR; MAGED2; FKBP5; USP7; EIF2AK4; RPS19; RPL7A; HSPA5; GAPDH; EIF4A1; EEF1G; EEF1A1; FBXO6; PRKACB; CDK9; CDK5; CDK4; ESX1; TPM3; FN1; C1QBP; TRAF3IP1; WDHD1; VDAC2; VAMP2; APP; CUL3; CUL5; PSMC4; RAD21;
    Blocking Peptide:
    For anti-TRAP1 (ARP30183_P050) antibody is Catalog # AAP30183
    Datasheets / Downloads:
    Printable datasheet for anti-TRAP1 (ARP30183_P050) antibody
    Sample Type Confirmation:

    TRAP1 is supported by BioGPS gene expression data to be expressed in HeLa

     
    X
    Ask a Question