website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$289.00
In Stock

TRAP1 Antibody - N-terminal region (ARP30183_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
TRAP1
NCBI Gene Id:
10131
Protein Name:
Heat shock protein 75 kDa, mitochondrial
Swissprot Id:
Q12931
Protein Accession #:
NP_057376
Nucleotide Accession #:
NM_016292
Alias Symbols:
HSP75, HSP90L
Description of Target:
Suppression of the expression of TRAP1 in mitochondria might play an important role in the induction of apoptosis caused via formation of ROS.
Protein Size (# AA):
704
Molecular Weight:
80kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TRAP1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TRAP1.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human TRAP1
Species Reactivity:
Dog, Guinea Pig, Human, Mouse, Rat
Predicted Homology Based on Immunogen Sequence:
Dog: 86%; Guinea Pig: 93%; Human: 100%; Mouse: 86%; Rat: 93%
Complete computational species homology data:
Anti-TRAP1 (ARP30183_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RRTTAQLGPRRNPAWSLQAGRLFSTQTAEDKEEPLHSIISSTESVQGSTS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
SUMO2; SUMO3; LGALS3BP; CEP72; CEP250; UBC; MDM2; OGFR; MAGED2; FKBP5; USP7; EIF2AK4; RPS19; RPL7A; HSPA5; GAPDH; EIF4A1; EEF1G; EEF1A1; FBXO6; PRKACB; CDK9; CDK5; CDK4; ESX1; TPM3; FN1; C1QBP; TRAF3IP1; WDHD1; VDAC2; VAMP2; APP; CUL3; CUL5; PSMC4; RAD21;
Blocking Peptide:
For anti-TRAP1 (ARP30183_P050) antibody is Catalog # AAP30183
Datasheets / Downloads:
Printable datasheet for anti-TRAP1 (ARP30183_P050) antibody
Sample Type Confirmation:

TRAP1 is supported by BioGPS gene expression data to be expressed in HeLa

 
X
Ask a Question