website statistics
Account Login 

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

TRAP1 Antibody - N-terminal region (ARP30183_P050)

Scroll Horizontally to view all Images
Print Page
  • Let us Help: Ask a Question
100 ul
In Stock

Conjugation Options

ARP30183_P050-FITC Conjugated

ARP30183_P050-HRP Conjugated

ARP30183_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Protein Name:
Heat shock protein 75 kDa, mitochondrial
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-136421 from Santa Cruz Biotechnology.
Description of Target:
Suppression of the expression of TRAP1 in mitochondria might play an important role in the induction of apoptosis caused via formation of ROS.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TRAP1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TRAP1.
The immunogen is a synthetic peptide directed towards the N-terminal region of Human TRAP1
Species Reactivity:
Dog, Guinea Pig, Human, Mouse, Rat
Predicted Homology Based on Immunogen Sequence:
Dog: 86%; Guinea Pig: 93%; Human: 100%; Mouse: 86%; Rat: 93%
Complete computational species homology data:
Anti-TRAP1 (ARP30183_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RRTTAQLGPRRNPAWSLQAGRLFSTQTAEDKEEPLHSIISSTESVQGSTS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-TRAP1 (ARP30183_P050) antibody is Catalog # AAP30183
Datasheets / Downloads:
Printable datasheet for anti-TRAP1 (ARP30183_P050) antibody
Sample Type Confirmation:

TRAP1 is supported by BioGPS gene expression data to be expressed in HeLa

Ask a Question