website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

TRAP1 Antibody - N-terminal region (ARP30183_P050)

Receive a free positive control (AHL006) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
Suppression of the expression of TRAP1 in mitochondria might play an important role in the induction of apoptosis caused via formation of ROS.
Gene Symbol:
NCBI Gene Id:
Alias Symbols:
Sample Type Confirmation:

TRAP1 is supported by BioGPS gene expression data to be expressed in HeLa

Tissue Tool:
Find tissues and cell lines supported to express TRAP1.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Heat shock protein 75 kDa, mitochondrial
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
The immunogen for Anti-TRAP1 antibody is: synthetic peptide directed towards the N-terminal region of Human TRAP1
Product Format:
Lyophilized powder
Complete computational species homology data:
TRAP1 Antibody - N-terminal region (ARP30183_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Pig: 93%; Rat: 93%; Guinea pig: 93%; Dog: 86%; Mouse: 86%
Species Reactivity:
Human, Rat, Guinea pig, Dog, Mouse
Datasheets / Downloads:
Printable datasheet for
anti-TRAP1 antibody
Peptide Sequence:
Synthetic peptide located within the following region: RRTTAQLGPRRNPAWSLQAGRLFSTQTAEDKEEPLHSIISSTESVQGSTS
Blocking Peptide:
Catalog # AAP30183
Key Reference:
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-TRAP1 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Ask a Question