website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

TRAP1 Antibody - N-terminal region (ARP30183_P050)

Receive a free positive control (AHL006) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
Suppression of the expression of TRAP1 in mitochondria might play an important role in the induction of apoptosis caused via formation of ROS.
Gene Symbol:
NCBI Gene Id:
Alias Symbols:
Sample Type Confirmation:

TRAP1 is supported by BioGPS gene expression data to be expressed in HeLa

Tissue Tool:
Find tissues and cell lines supported to express TRAP1.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Heat shock protein 75 kDa, mitochondrial
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
The immunogen for Anti-TRAP1 antibody is: synthetic peptide directed towards the N-terminal region of Human TRAP1
Product Format:
Lyophilized powder
Complete computational species homology data:
TRAP1 Antibody - N-terminal region (ARP30183_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Pig: 93%; Rat: 93%; Guinea pig: 93%; Dog: 86%; Mouse: 86%
Species Reactivity:
Human, Rat, Guinea pig, Dog, Mouse
Datasheets / Downloads:
Printable datasheet for
anti-TRAP1 antibody
Peptide Sequence:
Synthetic peptide located within the following region: RRTTAQLGPRRNPAWSLQAGRLFSTQTAEDKEEPLHSIISSTESVQGSTS
Blocking Peptide:
Catalog # AAP30183
Target Reference:
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-TRAP1 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for TRAP1 antibody (ARP30183)

Product page for TRAP1 antibody (ARP30183)
The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant TRAP1 antibody; Loxodonta africana TRAP1 antibody G3U8G1 91%
Chimpanzee ENSG00000126602 antibody; Pan troglodytes ENSG00000126602 antibody H2QAH2 100%
Chimpanzee HTPGB antibody; Pan troglodytes HTPGB antibody G2HE58 100%
Chinese hamster HTPGB antibody; Cricetulus griseus HTPGB antibody G3I027 84%
Dog TRAP1 antibody; Canis familiaris TRAP1 antibody F1PXQ9 85%
Guinea pig TRAP1 antibody; Cavia porcellus TRAP1 antibody H0V4E3 92%
Human TRAP1 antibody; Homo sapiens TRAP1 antibody Q9BV61 100%
Human TRAP1 antibody; Homo sapiens TRAP1 antibody Q12931 100%
Human TRAP1 antibody; Homo sapiens TRAP1 antibody I3L3L4 100%
Little brown bat TRAP1 antibody; Myotis lucifugus TRAP1 antibody G1NVE9 85%
Lowland gorilla TRAP1 antibody; Gorilla gorilla gorilla TRAP1 antibody G3QY61 100%
Mouse Trap1 antibody; Mus musculus Trap1 antibody Q9CQN1 85%
Mouse Trap1 antibody; Mus musculus Trap1 antibody Q922Z3 85%
Mouse Trap1 antibody; Mus musculus Trap1 antibody Q922R9 85%
Mouse Trap1 antibody; Mus musculus Trap1 antibody Q3UPJ8 85%
Mouse Trap1 antibody; Mus musculus Trap1 antibody Q3TSG8 85%
Mouse Trap1 antibody; Mus musculus Trap1 antibody Q3TK29 78%
Naked mole rat HTPGA antibody; Heterocephalus glaber HTPGA antibody G5B1G7 92%
Northern white-cheeked gibbon TRAP1 antibody; Nomascus leucogenys TRAP1 antibody G1RF60 100%
Rat Trap1 antibody; Rattus norvegicus Trap1 antibody Q5XHZ0 85%
Rhesus macaque TRAP1 antibody; Macaca mulatta TRAP1 antibody I2CY30 100%
Rhesus macaque TRAP1 antibody; Macaca mulatta TRAP1 antibody I0FK35 100%
Rhesus macaque TRAP1 antibody; Macaca mulatta TRAP1 antibody H9Z418 100%
Rhesus macaque TRAP1 antibody; Macaca mulatta TRAP1 antibody H9FNG4 100%
Rhesus macaque TRAP1 antibody; Macaca mulatta TRAP1 antibody F7EHQ6 100%
Sumatran orangutan DKFZp459E187 antibody; Pongo abelii DKFZp459E187 antibody Q5R6F4 92%
Sumatran orangutan TRAP1 antibody; Pongo abelii TRAP1 antibody H2NPZ6 92%
Thirteen-lined ground squirrel TRAP1 antibody; Spermophilus tridecemlineatus TRAP1 antibody I3M572 92%
West Indian ocean coelacanth TRAP1 antibody; Latimeria chalumnae TRAP1 antibody H3AXJ1 85%
White-tufted-ear marmoset TRAP1 antibody; Callithrix jacchus TRAP1 antibody F6PPG3 92%
Ask a Question