SIM1 Antibody - middle region (ARP33296_P050)

Catalog No: ARP33296_P050

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Canonical 86 kDa isoform is identified.

Host: Rabbit
Target Name: SIM1
Sample Tissue: Mouse Mouse Brain
Antibody Dilution: 1ug/ml

Mouse embryonic spinal cord. Embryonic day 15.

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human SIM1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: SSSKSKSRTSPYPQYSGFHTERSESDHDSQWGGSPLTDTASPQLLDPADR
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SIM1 (ARP33296_P050) antibody is Catalog # AAP33296
• Enhanced Validation:

  Relative Expression (Western Blot)

• Publications:

  Functional dissection of the Pax6 paired domain: Roles in neural tube patterning and peripheral nervous system development. Dev Biol. 413, 86-103 (2016)

• Description:
  View product citations for SIM1 Antibody - middle region (ARP33296_P050) on CiteAb

Target Info

• Gene Symbol: SIM1
• Alias Symbols: bHLHe14
• NCBI Gene Id: 6492
• Protein Name: Single-minded homolog 1
• Description of Target: SIM1 and SIM2 genes are Drosophila single-minded (sim) gene homologs. SIM1 transcript was detected only in fetal kidney out of various adult and fetal tissues tested. Since the sim gene plays an important role in Drosophila development and has peak levels of expression during the period of neurogenesis,it was proposed that the human SIM gene is a candidate for involvement in certain dysmorphic features (particularly the facial and skull characteristics), abnormalities of brain development, and/or mental retardation of Down syndrome.
• Uniprot ID: P81133
• Protein Accession #: NP_005059
• Nucleotide Accession #: NM_005068
• Protein Size (# AA): 766
• Molecular Weight: 86 kDa
• Protein Interactions: ARNT; HSP90AA1;