PPP1CB Antibody - C-terminal region (ARP65811_P050)

Catalog#: ARP65811_P050

• Size: 50ug

Human Fetal liver

• Description of Target: The protein encoded by this gene is one of the three catalytic subunits of protein phosphatase 1 (PP1). PP1 is a serine/threonine specific protein phosphatase known to be involved in the regulation of a variety of cellular processes, such as cell division, glycogen metabolism, muscle contractility, protein synthesis, and HIV-1 viral transcription. Mouse studies suggest that PP1 functions as a suppressor of learning and memory. Two alternatively spliced transcript variants encoding distinct isoforms have been observed.
• Gene Symbol: PPP1CB
• Official Gene Full Name: Protein phosphatase 1, catalytic subunit, beta isozyme
• Alias Symbols: MGC3672; PP-1B; PP1beta; PPP1CD
• Protein Accession#: NP_002700
• Nucleotide Accession#: NM_002709
• Swissprot Id: P62140
• Host: Rabbit
• Protein Size (# AA): 327
• Molecular Weight: 37kDa
• Application: WB
• Partner Proteins: PPP1R12B,PPP1R12C,PRKAR2A,PTK2,RB1,TLX1,WBP11,ZFYVE9,AKAP11,BRCA1,Cep72,HDAC7,INTS1,INTS6,KIAA0101,NCL,NCOR1,NONO,PPP1R10,PPP1R11,PPP1R12A,PPP1R12B,PPP1R15A,PPP1R2,PPP1R7,PPP1R8,PPP1R9B,PTK2,Ppp1r10,RYR2,SH2D4A,SMARCB1,Sass6,TMEM33,TOX4,TRIM28,UBC,WDR82
• Immunogen: The immunogen for Anti-PPP1CB antibody is: synthetic peptide directed towards the C-terminal region of Human PPP1CB
• Product Format: Lyophilized powder
• Peptide Sequence: Synthetic peptide located within the following region: LFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRP
• Blocking Peptide: Catalog # AAP65811
• Key Reference: N/A
• Reconstitution and Storage: Add 50 μl of distilled water. Final Anti-PPP1CB antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.