- Description of Target:
- N-Oct-3 (POU3F2) is a protein belonging to a large family of transcription factors that bind to the octameric DNA sequence ATGCAAAT. Most of these proteins share a highly homologous region, referred to as the POU domain, which occurs in several mammalian transcription factors, including the octamer-binding proteins Oct1 (POU2F1) and Oct2 (POU2F2), and the pituitary protein Pit1 (PIT1). Class III POU genes are expressed predominantly in the CNS. It is likely that CNS-specific transcription factors such as these play an important role in mammalian neurogenesis by regulating their diverse patterns of gene expression. N-Oct-3 is a protein belonging to a large family of transcription factors that bind to the octameric DNA sequence ATGCAAAT. Most of these proteins share a highly homologous region, referred to as the POU domain, which occurs in several mammalian transcription factors, including the octamer-binding proteins Oct1 (POU2F1; MIM 164175) and Oct2 (POU2F2; MIM 164176), and the pituitary protein Pit1 (PIT1; MIM 173110). Class III POU genes are expressed predominantly in the CNS. It is likely that CNS-specific transcription factors such as these play an important role in mammalian neurogenesis by regulating their diverse patterns of gene expression.[supplied by OMIM].
- Gene Symbol:
- POU3F2
- Official Gene Full Name:
- POU class 3 homeobox 2
- Alias Symbols:
- BRN2; OCT7; OTF7; OTF-7; POUF3; brn-2; oct-7
- Tissue Tool:
- Find tissues and cell lines supported to express POU3F2.
- Protein Accession# :
- NP_005595
- Nucleotide Accession#:
- NM_005604
- Swissprot Id:
- P20265
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 443
- Molecular Weight:
- 47kDa
- Application:
- WB
- Partner Proteins:
- ID2, MAPK8, MAPK8IP1, PAXIP1, RB1, SFRP2, WT1, MAPK8, MAPK8IP1, PAXIP1
- Immunogen:
- The immunogen for anti-POU3F2 antibody: synthetic peptide directed towards the C terminal of human POU3F2
- Product Format:
- Lyophilized powder
- Purification:
- Affinity Purified
- Complete computational species homology data:
- POU3F2 antibody - C-terminal region (P100858_P050)
- Predicted Homology Based on Immunogen Sequence:
- Bovine: 100%; Human: 100%; Pig: 100%; Rat: 100%
- Datasheets / Downloads:
- Printable datasheet for
anti-POU3F2 antibody
- P100858_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: QLEKEVVRVWFCNRRQKEKRMTPPGGTLPGAEDVYGGSRDTPPHHGVQTP
- Blocking Peptide:
- For anti-POU3F2 antibody is Catalog # AAP31219 (Previous Catalog # AAPP01964)
- Key Reference:
- Goodall,J., (2004) Mol. Cell. Biol. 24 (7), 2923-2931
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-POU3F2 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: POU3F2 antibody tested with Human Transfected 293T Cells (P100858_P050)
Aviva Systems Biology is the original manufacturer of this POU3F2 antibody (P100858_P050)
Click here to view the POU3F2 antibody Western Blot Protocol
Product Datasheet Link: POU3F2 antibody (P100858_P050)
WB Suggested Anti-POU3F2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Transfected 293T
Western Blot image: 
Description of Target: N-Oct-3 (POU3F2) is a protein belonging to a large family of transcription factors that bind to the octameric DNA sequence ATGCAAAT. Most of these proteins share a highly homologous region, referred to as the POU domain, which occurs in several mammalian transcription factors, including the octamer-binding proteins Oct1 (POU2F1) and Oct2 (POU2F2), and the pituitary protein Pit1 (PIT1). Class III POU genes are expressed predominantly in the CNS. It is likely that CNS-specific transcription factors such as these play an important role in mammalian neurogenesis by regulating their diverse patterns of gene expression. N-Oct-3 is a protein belonging to a large family of transcription factors that bind to the octameric DNA sequence ATGCAAAT. Most of these proteins share a highly homologous region, referred to as the POU domain, which occurs in several mammalian transcription factors, including the octamer-binding proteins Oct1 (POU2F1; MIM 164175) and Oct2 (POU2F2; MIM 164176), and the pituitary protein Pit1 (PIT1; MIM 173110). Class III POU genes are expressed predominantly in the CNS. It is likely that CNS-specific transcription factors such as these play an important role in mammalian neurogenesis by regulating their diverse patterns of gene expression.[supplied by OMIM].
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s POU3F2 antibody (P100858_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
