SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP46851_P050
Price: $0.00
SKU
ARP46851_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for ARP46851_P050
Product Info
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB, IF
Additional InformationIHC Information: Testis
IHC Information: Adrenal
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human BACE1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 91%
Peptide SequenceSynthetic peptide located within the following region: GQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTY
Concentration0.5 mg/ml
Blocking PeptideCatalog # AAP46851 (Previous Catalog # AAPP27647)
Enhanced Validation
SPR Affinity Characterization Avivasheild
ReferenceShimizu,H., (2008) Mol. Cell. Biol. 28 (11), 3663-3671
Gene SymbolBACE1
Gene Full NameBeta-site APP-cleaving enzyme 1
Alias SymbolsASP2, BACE, HSPC104
NCBI Gene Id23621
Protein NameBeta-secretase 1
Description of TargetCerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease. Amyloid beta peptide is generated by proteolytic cleavage of amyloid precursor protein (APP) by two proteases, one of which is the protein. BACE1, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease that is found mainly in the Golgi.Cerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease. Amyloid beta peptide is generated by proteolytic cleavage of amyloid precursor protein (APP) by two proteases, one of which is the protein encoded by this gene. The encoded protein, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease that is found mainly in the Golgi. Four transcript variants encoding different isoforms have been described for this gene.
Uniprot IDP56817
Protein Accession #NP_036236
Nucleotide Accession #NM_012104
Protein Size (# AA)501
Molecular Weight51 kDa
Protein InteractionsCOPS5; BRI3; RANBP9; APP; PCSK9; GGA1; GGA3; GGA2; UBC; FBXO2; CMPK1; ITM2C; KHSRP; PLSCR1; NCSTN; PDIA3; CSNK1D; SELPLG; ATP1B1; PSAP; FURIN; MMP2; LRP1; PSEN1;
  1. What is the species homology for "BACE1 Antibody - N-terminal region (ARP46851_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "BACE1 Antibody - N-terminal region (ARP46851_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "BACE1 Antibody - N-terminal region (ARP46851_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "BACE1 Antibody - N-terminal region (ARP46851_P050)"?

    This target may also be called "ASP2, BACE, HSPC104" in publications.

  5. What is the shipping cost for "BACE1 Antibody - N-terminal region (ARP46851_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "BACE1 Antibody - N-terminal region (ARP46851_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "BACE1 Antibody - N-terminal region (ARP46851_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "51 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "BACE1 Antibody - N-terminal region (ARP46851_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "BACE1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "BACE1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "BACE1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "BACE1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "BACE1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "BACE1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:BACE1 Antibody - N-terminal region (ARP46851_P050)
Your Rating
We found other products you might like!