- Description of Target:
- Zfp90 may function as a repressor or silencer protein, and most likely exerts its repressing activity upon zinc-dependent binding to DNA. It may be involved in proper spermatogenesis by repressing the expression of genes unnecessary or incompatible with the maintenance of a haploid cell state.
- Gene Symbol:
- Zfp90
- Official Gene Full Name:
- Zinc finger protein 90
- Alias Symbols:
- 6430515L01Rik; KRAB17; NK10; Zfp64; Zfp83; mKIAA1954
- Tissue Tool:
- Find tissues and cell lines supported to express Zfp90.
- Protein Accession# :
- NP_035894
- Nucleotide Accession#:
- NM_011764
- Swissprot Id:
- Q61967
- Host:
- Rabbit
- Protein Size (# AA):
- 636
- Molecular Weight:
- 72kDa
- Application:
- WB
- Product Format:
- Lyophilized powder
- Complete computational species homology data:
- Zfp90 antibody - N-terminal region (ARP32175_P050)
- Predicted Homology Based on Immunogen Sequence:
- Bovine: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
- Datasheets / Downloads:
- Printable datasheet for
anti-Zfp90 antibody
- ARP32175_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: HLVSLGYQVSKPEVIFKLEQGEEPWISEKEIQRPFCPDWKTRPESSRSPQ
- Blocking Peptide:
- For anti-Zfp90 antibody is Catalog # AAP32175 (Previous Catalog # AAPP03148)
- Key Reference:
- N/A
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-Zfp90 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
