SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP71752_P050
Price: $0.00
SKU
ARP71752_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-TIMM10 (ARP71752_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Human TIMM10
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 92%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: AELSKGESVCLDRCVSKYLDIHERMGKKLTELSMQDEELMKRVQQSSGPA
Concentration0.5 mg/ml
Blocking PeptideFor anti-TIMM10 (ARP71752_P050) antibody is Catalog # AAP71752
Sample Type Confirmation

TIMM10 is supported by BioGPS gene expression data to be expressed in 721_B

Gene SymbolTIMM10
Alias SymbolsTIM10, TIM10A, TIMM10A
NCBI Gene Id26519
Protein NameMitochondrial import inner membrane translocase subunit Tim10
Description of TargetThe mitochondrial protein encoded by this gene belongs to a family of evolutionarily conserved proteins that are organized in heterooligomeric complexes in the mitochondrial intermembrane space. These proteins mediate the import and insertion of hydrophobic membrane proteins into the mitochondrial inner membrane, functioning as intermembrane space chaperones for the highly insoluble carrier proteins.
Uniprot IDP62072
Protein Accession #NP_036588
Nucleotide Accession #NM_012456
Protein Size (# AA)90
Molecular Weight9kDa
Protein InteractionsUBC; BAG3; CHCHD4; TIMM9; NNT; NOMO1; HNRNPR; SUGP2; SART1; UQCRB; SSR4; SFPQ; RPS2; MRPL49; SLC25A6; Nedd4;
  1. What is the species homology for "TIMM10 Antibody - middle region (ARP71752_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "TIMM10 Antibody - middle region (ARP71752_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TIMM10 Antibody - middle region (ARP71752_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TIMM10 Antibody - middle region (ARP71752_P050)"?

    This target may also be called "TIM10, TIM10A, TIMM10A" in publications.

  5. What is the shipping cost for "TIMM10 Antibody - middle region (ARP71752_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TIMM10 Antibody - middle region (ARP71752_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TIMM10 Antibody - middle region (ARP71752_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "9kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TIMM10 Antibody - middle region (ARP71752_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TIMM10"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TIMM10"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TIMM10"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TIMM10"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TIMM10"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TIMM10"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TIMM10 Antibody - middle region (ARP71752_P050)
Your Rating