RET antibody - C-terminal region (ARP30878_P050)

Catalog#: ARP30878_P050

• Size: 50ug

Human 293T

• Description of Target: This gene, a member of the cadherin superfamily, encodes one of the receptor tyrosine kinases, which are cell-surface molecules that transduce signals for cell growth and differentiation. This gene plays a crucial role in neural crest development, and it can undergo oncogenic activation in vivo and in vitro by cytogenetic rearrangement. Mutations in this gene are associated with the disorders multiple endocrine neoplasia, type IIA, multiple endocrine neoplasia, type IIB, Hirschsprung disease, and medullary thyroid carcinoma. Two transcript variants encoding different isoforms have been found for this gene. Additional transcript variants have been described but their biological validity has not been confirmed.
• Gene Symbol: RET
• Official Gene Full Name: Ret proto-oncogene
• Alias Symbols: CDHF12; CDHR16; HSCR1; MEN2A; MEN2B; MTC1; PTC; RET-ELE1; RET51
• Protein Accession#: NP_000314
• Nucleotide Accession#: NM_000323
• Swissprot Id: P07949
• Host: Rabbit
• Protein Size (# AA): 1114
• Molecular Weight: 123kDa
• Application: WB
• Partner Proteins: FRS2,PLCG1,SHC1,AKAP5,CBL,CBLB,CRK,DOK1,DOK2,DOK3,DOK4,DOK5,DOK6,FRS2,GAB1,GDNF,GFRA1,GRB10,GRB2,GRB7,MAPK1,MAPK14,MAPK3,MAPK8,NRTN,PDLIM7,PIK3R1,PLCG1,PRKAR2A,PTK2,PTPN11,RET,SHC1,SHC3,SRC,STAT3,CRK,DOK1,DOK2,DOK4,DOK5,DOK6,FRS2,GFRA1,GRB10,GRB2,GRB7,IKBKG,MCRS1,NRTN,PDLIM7,PLCG1,PTPRF,SHC1,SRC,STAT3
• Product Format: Lyophilized powder
• Predicted Homology Based on Immunogen Sequence: African clawed frog: 100%; Bovine: 100%; Chicken: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 90%; Mouse: 90%; Rat: 90%
• Peptide Sequence: Synthetic peptide located within the following region: EMKLVHRDLAARNILVAEGRKMKISDFGLSRDVYEEDSYVKRSQGRIPVK
• Blocking Peptide: For anti-RET antibody is Catalog # AAP30878
• Key Reference: N/A
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-RET antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.