website statistics
Account Login 

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

RET antibody - C-terminal region (ARP30878_P050)

  • Catalog#: ARP30878_P050
  • Domestic: within 1-2 days delivery International: 1-2 days

    *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges

    - Trial Size Available. Trial size is not available for conjugation.
Scroll Horizontally to view all Images
Free trial-size samples may be available for this item. Please go here for more information.
Print Page
100 ul
    $289.00
    In Stock

    Conjugation Options

    ARP30878_P050-FITC Conjugated

    ARP30878_P050-HRP Conjugated

    ARP30878_P050-Biotin Conjugated

    Free trial-size samples may be available for this item. Please go here for more information.
    Gene Symbol:
    RET
    NCBI Gene Id:
    5979
    Official Gene Full Name:
    Ret proto-oncogene
    Protein Name:
    Proto-oncogene tyrosine-protein kinase receptor Ret
    Swissprot Id:
    P07949
    Protein Accession #:
    NP_000314
    Nucleotide Accession #:
    NM_000323
    Alias Symbols:
    CDHF12, CDHR16, HSCR1, MEN2A, MEN2B, MTC1, PTC, RET-ELE1, RET51
    Replacement Item:
    This antibody may replace item sc-101422 from Santa Cruz Biotechnology.
    Description of Target:
    This gene, a member of the cadherin superfamily, encodes one of the receptor tyrosine kinases, which are cell-surface molecules that transduce signals for cell growth and differentiation. This gene plays a crucial role in neural crest development, and it can undergo oncogenic activation in vivo and in vitro by cytogenetic rearrangement. Mutations in this gene are associated with the disorders multiple endocrine neoplasia, type IIA, multiple endocrine neoplasia, type IIB, Hirschsprung disease, and medullary thyroid carcinoma. Two transcript variants encoding different isoforms have been found for this gene. Additional transcript variants have been described but their biological validity has not been confirmed.
    Protein Size (# AA):
    1114
    Molecular Weight:
    123kDa
    Host:
    Rabbit
    Clonality:
    Polyclonal
    Purification:
    Affinity Purified
    Application:
    WB
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express RET.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express RET.
    Species Reactivity:
    Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
    Predicted Homology Based on Immunogen Sequence:
    Cow: 100%; Dog: 100%; Guinea Pig: 90%; Horse: 100%; Human: 100%; Mouse: 90%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
    Complete computational species homology data:
    Anti-RET (ARP30878_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: EMKLVHRDLAARNILVAEGRKMKISDFGLSRDVYEEDSYVKRSQGRIPVK
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Concentration:
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    NOTCH2NL; UBC; CBLC; PDLIM7; HSP90AA1; GRB2; CBL; RET; MCRS1; IKBKG; DOK3; DOK5; DOK4; DOK6; SHC3; FRS2; DOK2; AKAP5; CBLB; GAB1; DOK1; NRTN; MAPK3; GRB10; GRB7; GFRA1; MAPK8; GDNF; PTK2; SHC1; MAPK14; SRC; MAPK1; PRKAR2A; PTPN11; PLCG1; PIK3R1; CRK; STAT
    Blocking Peptide:
    For anti-RET (ARP30878_P050) antibody is Catalog # AAP30878
    Datasheets / Downloads:
    Printable datasheet for anti-RET (ARP30878_P050) antibody
     
    X
    Ask a Question