website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

RET antibody - C-terminal region (ARP30878_P050)

Receive a free positive control (AHL005) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
This gene, a member of the cadherin superfamily, encodes one of the receptor tyrosine kinases, which are cell-surface molecules that transduce signals for cell growth and differentiation. This gene plays a crucial role in neural crest development, and it can undergo oncogenic activation in vivo and in vitro by cytogenetic rearrangement. Mutations in this gene are associated with the disorders multiple endocrine neoplasia, type IIA, multiple endocrine neoplasia, type IIB, Hirschsprung disease, and medullary thyroid carcinoma. Two transcript variants encoding different isoforms have been found for this gene. Additional transcript variants have been described but their biological validity has not been confirmed.
Gene Symbol:
RET
Official Gene Full Name:
Ret proto-oncogene
NCBI Gene Id:
5979
Alias Symbols:
CDHF12; CDHR16; HSCR1; MEN2A; MEN2B; MTC1; PTC; RET-ELE1; RET51
Tissue Tool:
Find tissues and cell lines supported to express RET.
Protein Accession #:
NP_000314
Nucleotide Accession#:
NM_000323
Swissprot Id:
P07949
Host:
Rabbit
Protein Name:
Proto-oncogene tyrosine-protein kinase receptor Ret
Protein Size (# AA):
1114
Molecular Weight:
123kDa
Application:
WB
Partner Proteins:
FRS2,PLCG1,SHC1,AKAP5,CBL,CBLB,CRK,DOK1,DOK2,DOK3,DOK4,DOK5,DOK6,FRS2,GAB1,GDNF,GFRA1,GRB10,GRB2,GRB7,MAPK1,MAPK14,MAPK3,MAPK8,NRTN,PDLIM7,PIK3R1,PLCG1,PRKAR2A,PTK2,PTPN11,RET,SHC1,SHC3,SRC,STAT3,CRK,DOK1,DOK2,DOK4,DOK5,DOK6,FRS2,GFRA1,GRB10,GRB2,GRB7,IKBKG,MCRS1,NRTN,PDLIM7,PLCG1,PTPRF,SHC1,SRC,STAT3
Product Format:
Lyophilized powder
Complete computational species homology data:
RET antibody - C-terminal region (ARP30878_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Mouse: 90%; Guinea pig: 90%
Species Reactivity:
Zebrafish, Human, Bovine, Dog, Pig, Horse, Rabbit, Rat, Guinea pig, Mouse
Datasheets / Downloads:
Printable datasheet for
anti-RET antibody
- ARP30878_P050
Peptide Sequence:
Synthetic peptide located within the following region: EMKLVHRDLAARNILVAEGRKMKISDFGLSRDVYEEDSYVKRSQGRIPVK
Blocking Peptide:
For anti-RET antibody is Catalog # AAP30878
Key Reference:
N/A
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-RET antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question