website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

RET antibody - C-terminal region (ARP30878_P050)

Receive a free positive control (AHL005) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
This gene, a member of the cadherin superfamily, encodes one of the receptor tyrosine kinases, which are cell-surface molecules that transduce signals for cell growth and differentiation. This gene plays a crucial role in neural crest development, and it can undergo oncogenic activation in vivo and in vitro by cytogenetic rearrangement. Mutations in this gene are associated with the disorders multiple endocrine neoplasia, type IIA, multiple endocrine neoplasia, type IIB, Hirschsprung disease, and medullary thyroid carcinoma. Two transcript variants encoding different isoforms have been found for this gene. Additional transcript variants have been described but their biological validity has not been confirmed.
Gene Symbol:
RET
Official Gene Full Name:
Ret proto-oncogene
NCBI Gene Id:
5979
Alias Symbols:
CDHF12; CDHR16; HSCR1; MEN2A; MEN2B; MTC1; PTC; RET-ELE1; RET51
Tissue Tool:
Find tissues and cell lines supported to express RET.
Protein Accession #:
NP_000314
Nucleotide Accession#:
NM_000323
Swissprot Id:
P07949
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Proto-oncogene tyrosine-protein kinase receptor Ret
Protein Size (# AA):
1114
Molecular Weight:
123kDa
Application:
WB
Partner Proteins:
FRS2,PLCG1,SHC1,AKAP5,CBL,CBLB,CRK,DOK1,DOK2,DOK3,DOK4,DOK5,DOK6,FRS2,GAB1,GDNF,GFRA1,GRB10,GRB2,GRB7,MAPK1,MAPK14,MAPK3,MAPK8,NRTN,PDLIM7,PIK3R1,PLCG1,PRKAR2A,PTK2,PTPN11,RET,SHC1,SHC3,SRC,STAT3,CRK,DOK1,DOK2,DOK4,DOK5,DOK6,FRS2,GFRA1,GRB10,GRB2,GRB7,IKBKG,MCRS1,NRTN,PDLIM7,PLCG1,PTPRF,SHC1,SRC,STAT3
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
RET antibody - C-terminal region (ARP30878_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Mouse: 90%; Guinea pig: 90%
Species Reactivity:
Zebrafish, Human, Bovine, Dog, Pig, Horse, Rabbit, Rat, Guinea pig, Mouse
Datasheets / Downloads:
Printable datasheet for
anti-RET antibody
- ARP30878_P050
Peptide Sequence:
Synthetic peptide located within the following region: EMKLVHRDLAARNILVAEGRKMKISDFGLSRDVYEEDSYVKRSQGRIPVK
Blocking Peptide:
For anti-RET antibody is Catalog # AAP30878
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-RET antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for RET antibody (ARP30878)

Product page for RET antibody (ARP30878)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African clawed frog ret antibody; Xenopus laevis ret antibody Q9DGL0 100%
African clawed frog ret-A antibody; Xenopus laevis ret-A antibody B7ZRI5 100%
African clawed frog ret-A antibody; Xenopus laevis ret-A antibody B7ZRI3 100%
African elephant RET antibody; Loxodonta africana RET antibody G3TIZ2 100%
Axolotl c-ret antibody; Ambystoma mexicanum c-ret antibody Q8JG59 100%
Bornean orangutan RET antibody; Pongo pygmaeus RET antibody Q8MJ57 100%
Bovine RET antibody; Bos taurus RET antibody F1MS00 100%
Chicken RET antibody; Gallus gallus RET antibody Q9PSD4 100%
Chicken RET antibody; Gallus gallus RET antibody Q9PS75 100%
Chicken RET antibody; Gallus gallus RET antibody Q90601 100%
Chicken RET antibody; Gallus gallus RET antibody F1NL50 100%
Chicken RET antibody; Gallus gallus RET antibody F1NL49 100%
Chicken RET antibody; Gallus gallus RET antibody F1NL37 100%
Chicken RET antibody; Gallus gallus RET antibody F1NL36 100%
Chicken RET antibody; Gallus gallus RET antibody F1NI70 100%
Chimpanzee RET antibody; Pan troglodytes RET antibody Q8MJ59 100%
Common turkey RET antibody; Meleagris gallopavo RET antibody G3UR22 100%
Common turkey RET antibody; Meleagris gallopavo RET antibody G3UPL6 100%
Common turkey RET antibody; Meleagris gallopavo RET antibody G1MR14 100%
Dog Cfa.206 antibody; Canis familiaris Cfa.206 antibody F1PLF6 100%
Duckbill platypus RET antibody; Ornithorhynchus anatinus RET antibody F6ZPK1 100%
Duckbill platypus RET antibody; Ornithorhynchus anatinus RET antibody F6ZPJ2 100%
Gray short-tailed opossum RET antibody; Monodelphis domestica RET antibody F7G7S6 100%
Green pufferfish RET antibody; Tetraodon fluviatilis RET antibody Q9YH35 100%
Guinea pig RET antibody; Cavia porcellus RET antibody H0VQB6 90%
Harbor seal RET antibody; Phoca vitulina RET antibody Q6IZA6 100%
Human RET antibody; Homo sapiens RET antibody P07949 100%
Human RET antibody; Homo sapiens RET antibody P07949-2 100%
Human RET antibody; Homo sapiens RET antibody Q9UMQ4 100%
Human RET antibody; Homo sapiens RET antibody Q8NFE8 100%
Human RET antibody; Homo sapiens RET antibody Q2VJ45 100%
Human RET antibody; Homo sapiens RET antibody Q15850 100%
Human RET antibody; Homo sapiens RET antibody F8TLW0 100%
Human RET antibody; Homo sapiens RET antibody F8TLS5 100%
Human RET antibody; Homo sapiens RET antibody B4DGX8 100%
Human RET/PTC2 antibody; Homo sapiens RET/PTC2 antibody Q15300 90%
Little brown bat RET antibody; Myotis lucifugus RET antibody G1PWX2 100%
Lowland gorilla RET antibody; Gorilla gorilla gorilla RET antibody G3QLZ3 100%
Mouse RET antibody; Mus musculus RET antibody P35546 90%
Mouse RET antibody; Mus musculus RET antibody P35546-2 90%
Northern white-cheeked gibbon RET antibody; Nomascus leucogenys RET antibody G1S143 100%
Northern white-cheeked gibbon RET antibody; Nomascus leucogenys RET antibody G1S142 100%
Pig RET antibody; Sus scrofa RET antibody F1RG22 100%
Rabbit RET antibody; Oryctolagus cuniculus RET antibody G1T0Q2 100%
Rat Ret antibody; Rattus norvegicus Ret antibody Q9EPC3 90%
Rat Ret antibody; Rattus norvegicus Ret antibody Q9EPA1 90%
Rat Ret antibody; Rattus norvegicus Ret antibody G3V9H8 90%
Rhesus macaque RET antibody; Macaca mulatta RET antibody F6S7W7 100%
Small-eared galago RET antibody; Otolemur garnettii RET antibody H0X4E9 100%
Tasmanian devil RET antibody; Sarcophilus harrisii RET antibody G3WA34 100%
Three-spined stickleback RET antibody; Gasterosteus aculeatus RET antibody G3NG57 100%
Western clawed frog ret antibody; Xenopus tropicalis ret antibody F7DU26 100%
western gorilla RET antibody; Gorilla gorilla RET antibody Q8MJ58 100%
White-tufted-ear marmoset RET antibody; Callithrix jacchus RET antibody F7I536 100%
Zebra finch RET antibody; Taeniopygia guttata RET antibody H0Z7B3 100%
Zebrafish ret antibody; Danio rerio ret antibody A8E7C6 100%
Zebrafish ret1 antibody; Danio rerio ret1 antibody P79726 100%
Zebrafish ret1 antibody; Danio rerio ret1 antibody O42362 100%
Zebrafish ret1 antibody; Danio rerio ret1 antibody A8E7C7 100%
 
X
Ask a Question