website statistics
Account Login 

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

US

Pou4f3 antibody - N-terminal region (ARP33064_P050)

  • Catalog#: ARP33064_P050
  • Domestic: within 1-2 days delivery International: 1-2 days

    *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges

    - Trial Size Available. Trial size is not available for conjugation.
Scroll Horizontally to view all Images
Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
100 ul
    $289.00
    In Stock
    Click here to learn more about Aviva's By-Request Conjugation Service.
    Gene Symbol:
    Pou4f3
    NCBI Gene Id:
    18998
    Official Gene Full Name:
    POU domain, class 4, transcription factor 3
    Protein Name:
    POU domain, class 4, transcription factor 3
    Swissprot Id:
    Q63955
    Protein Accession #:
    NP_620395
    Nucleotide Accession #:
    NM_138945
    Alias Symbols:
    Brn3.1, Brn3c, ddl, dreidel
    Description of Target:
    Pou4f3 may play a role in determining or maintaining the identities of a small subset of visual system neurons.
    Protein Size (# AA):
    338
    Molecular Weight:
    37kDa
    Host:
    Rabbit
    Clonality:
    Polyclonal
    Purification:
    Affinity Purified
    Application:
    WB
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express Pou4f3.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express Pou4f3.
    Species Reactivity:
    Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
    Predicted Homology Based on Immunogen Sequence:
    Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 85%
    Complete computational species homology data:
    Anti-Pou4f3 (ARP33064_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: PKFSSLHSGSEAMRRVCLPAPQLQGNIFGSFDESLLARAEALAAVDIVSH
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Concentration:
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Blocking Peptide:
    For anti-Pou4f3 (ARP33064_P050) antibody is Catalog # AAP33064 (Previous Catalog # AAPP05175)
    Datasheets / Downloads:
    Printable datasheet for anti-Pou4f3 (ARP33064_P050) antibody
     
    X
    Ask a Question