- Description of Target:
- Pou4f3 may play a role in determining or maintaining the identities of a small subset of visual system neurons.
- Gene Symbol:
- Pou4f3
- Official Gene Full Name:
- POU domain, class 4, transcription factor 3
- Alias Symbols:
- Brn3.1; Brn3c; ddl; dreidel
- Tissue Tool:
- Find tissues and cell lines supported to express Pou4f3.
- Protein Accession# :
- NP_620395
- Nucleotide Accession#:
- NM_138945
- Swissprot Id:
- Q63955
- Host:
- Rabbit
- Protein Size (# AA):
- 338
- Molecular Weight:
- 37kDa
- Application:
- WB
- Product Format:
- Lyophilized powder
- Complete computational species homology data:
- Pou4f3 antibody - N-terminal region (ARP33064_P050)
- Predicted Homology Based on Immunogen Sequence:
- Bovine: 100%; Dog: 100%; Guinea pig: 100%; Rat: 100%; Pig: 92%; Zebrafish: 84%
- Datasheets / Downloads:
- Printable datasheet for
anti-Pou4f3 antibody
- ARP33064_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: PKFSSLHSGSEAMRRVCLPAPQLQGNIFGSFDESLLARAEALAAVDIVSH
- Blocking Peptide:
- For anti-Pou4f3 antibody is Catalog # AAP33064 (Previous Catalog # AAPP05175)
- Key Reference:
- N/A
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-Pou4f3 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
