website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

Pou4f3 antibody - N-terminal region (ARP33064_P050)

Description of Target:
Pou4f3 may play a role in determining or maintaining the identities of a small subset of visual system neurons.
Gene Symbol:
Pou4f3
Official Gene Full Name:
POU domain, class 4, transcription factor 3
NCBI Gene Id:
18998
Alias Symbols:
Brn3.1; Brn3c; ddl; dreidel
Tissue Tool:
Find tissues and cell lines supported to express Pou4f3.
Protein Accession #:
NP_620395
Nucleotide Accession#:
NM_138945
Swissprot Id:
Q63955
Host:
Rabbit
Protein Name:
POU domain, class 4, transcription factor 3
Protein Size (# AA):
338
Molecular Weight:
37kDa
Application:
WB
Product Format:
Lyophilized powder
Complete computational species homology data:
Pou4f3 antibody - N-terminal region (ARP33064_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Horse: 92%; Zebrafish: 85%
Species Reactivity:
Rat, Bovine, Dog, Pig, Guinea pig, Human, Mouse, Horse, Zebrafish
Datasheets / Downloads:
Printable datasheet for
anti-Pou4f3 antibody
- ARP33064_P050
Peptide Sequence:
Synthetic peptide located within the following region: PKFSSLHSGSEAMRRVCLPAPQLQGNIFGSFDESLLARAEALAAVDIVSH
Blocking Peptide:
For anti-Pou4f3 antibody is Catalog # AAP33064 (Previous Catalog # AAPP05175)
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-Pou4f3 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for Pou4f3 antibody (ARP33064)

Product page for Pou4f3 antibody (ARP33064)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant POU4F3 antibody; Loxodonta africana POU4F3 antibody G3U7B0 100%
Bovine POU4F3 antibody; Bos taurus POU4F3 antibody E1BJ03 100%
Dog POU4F3 antibody; Canis familiaris POU4F3 antibody E2QUY3 100%
Giant panda LOC100476988 antibody; Ailuropoda melanoleuca LOC100476988 antibody D2HQF8 100%
Gray short-tailed opossum POU4F3 antibody; Monodelphis domestica POU4F3 antibody F6WMZ8 100%
Guinea pig Pou4f3 antibody; Cavia porcellus Pou4f3 antibody H0W6C1 100%
Horse LOC100071960 antibody; Equus caballus LOC100071960 antibody F7DKN8 92%
Human PO4F3 antibody; Homo sapiens PO4F3 antibody Q15319 100%
Little brown bat POU4F3 antibody; Myotis lucifugus POU4F3 antibody G1Q3H1 100%
Lowland gorilla POU4F3 antibody; Gorilla gorilla gorilla POU4F3 antibody G3RTH8 100%
Lowland gorilla POU4F3 antibody; Gorilla gorilla gorilla POU4F3 antibody G3R9P3 100%
Mouse PO4F3 antibody; Mus musculus PO4F3 antibody Q63955 100%
Northern white-cheeked gibbon POU4F3 antibody; Nomascus leucogenys POU4F3 antibody G1RFQ1 100%
Pig POU4F3 antibody; Sus scrofa POU4F3 antibody F1RM14 92%
Rat Pou4f3 antibody; Rattus norvegicus Pou4f3 antibody D3ZTL1 100%
Rhesus macaque POU4F3 antibody; Macaca mulatta POU4F3 antibody F6XDC9 100%
Small-eared galago POU4F3 antibody; Otolemur garnettii POU4F3 antibody H0XQ64 100%
Tasmanian devil POU4F3 antibody; Sarcophilus harrisii POU4F3 antibody G3W1P6 100%
Three-spined stickleback POU4F3 antibody; Gasterosteus aculeatus POU4F3 antibody G3QBX7 92%
Western clawed frog LOC100498313 antibody; Xenopus tropicalis LOC100498313 antibody F6ZEC8 84%
White-tufted-ear marmoset POU4F3 antibody; Callithrix jacchus POU4F3 antibody F7G4P3 100%
Zebrafish PO4F3 antibody; Danio rerio PO4F3 antibody Q90435 84%
Zebrafish pou4f3 antibody; Danio rerio pou4f3 antibody F1R7T5 84%
Zebrafish zgc:158291 antibody; Danio rerio zgc:158291 antibody A1A5W2 76%
 
X
Ask a Question