website statistics

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

Pou4f3 antibody - N-terminal region (ARP33064_P050)

Scroll Horizontally to view all Images
Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
  • Let us Help: Ask a Question
100 ul
In Stock

Conjugation Options

ARP33064_P050-FITC Conjugated

ARP33064_P050-HRP Conjugated

ARP33064_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
POU domain, class 4, transcription factor 3
Protein Name:
POU domain, class 4, transcription factor 3
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Brn3.1, Brn3c, ddl, dreidel
Description of Target:
Pou4f3 may play a role in determining or maintaining the identities of a small subset of visual system neurons.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Pou4f3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Pou4f3.
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 85%
Complete computational species homology data:
Anti-Pou4f3 (ARP33064_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PKFSSLHSGSEAMRRVCLPAPQLQGNIFGSFDESLLARAEALAAVDIVSH
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-Pou4f3 (ARP33064_P050) antibody is Catalog # AAP33064 (Previous Catalog # AAPP05175)
Datasheets / Downloads:
Printable datasheet for anti-Pou4f3 (ARP33064_P050) antibody
Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...