website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

Pou4f3 antibody - N-terminal region (ARP33064_P050)

Description of Target:
Pou4f3 may play a role in determining or maintaining the identities of a small subset of visual system neurons.
Gene Symbol:
Pou4f3
Official Gene Full Name:
POU domain, class 4, transcription factor 3
NCBI Gene Id:
18998
Alias Symbols:
Brn3.1; Brn3c; ddl; dreidel
Tissue Tool:
Find tissues and cell lines supported to express Pou4f3.
Protein Accession #:
NP_620395
Nucleotide Accession#:
NM_138945
Swissprot Id:
Q63955
Host:
Rabbit
Protein Name:
POU domain, class 4, transcription factor 3
Protein Size (# AA):
338
Molecular Weight:
37kDa
Application:
WB
Product Format:
Lyophilized powder
Complete computational species homology data:
Pou4f3 antibody - N-terminal region (ARP33064_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Horse: 92%; Zebrafish: 85%
Species Reactivity:
Rat, Bovine, Dog, Pig, Guinea pig, Human, Mouse, Horse, Zebrafish
Datasheets / Downloads:
Printable datasheet for
anti-Pou4f3 antibody
- ARP33064_P050
Peptide Sequence:
Synthetic peptide located within the following region: PKFSSLHSGSEAMRRVCLPAPQLQGNIFGSFDESLLARAEALAAVDIVSH
Blocking Peptide:
For anti-Pou4f3 antibody is Catalog # AAP33064 (Previous Catalog # AAPP05175)
Key Reference:
N/A
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-Pou4f3 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question