website statistics
Account Login 

Aviva Systems Biology office will be closed for Labor Day - 9/7/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

Pou4f3 antibody - N-terminal region (ARP33064_P050)

Description of Target:
Pou4f3 may play a role in determining or maintaining the identities of a small subset of visual system neurons.
Gene Symbol:
Official Gene Full Name:
POU domain, class 4, transcription factor 3
NCBI Gene Id:
Alias Symbols:
Brn3.1; Brn3c; ddl; dreidel
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Pou4f3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Pou4f3.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Name:
POU domain, class 4, transcription factor 3
Protein Size (# AA):
Molecular Weight:
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Affinity Purified
Complete computational species homology data:
Anti-Pou4f3 (ARP33064_P050)
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 85%
Species Reactivity:
Cow; Dog; Guinea Pig; Horse; Human; Mouse; Rat; Zebrafish
Datasheets / Downloads:
Printable datasheet for anti-Pou4f3 (ARP33064_P050) antibody
Peptide Sequence:
Synthetic peptide located within the following region: PKFSSLHSGSEAMRRVCLPAPQLQGNIFGSFDESLLARAEALAAVDIVSH
Blocking Peptide:
For anti-Pou4f3 (ARP33064_P050) antibody is Catalog # AAP33064 (Previous Catalog # AAPP05175)
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Ask a Question