PIGX Antibody - C-terminal region (ARP60842_P050)

Catalog No: ARP60842_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-PIGX Antibody
Titration: 1.0 ug/ml
Positive Control: NCI-H226 Whole Cell

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Cow, Dog, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 91%; Dog: 85%; Horse: 85%; Human: 100%; Pig: 83%; Rabbit: 85%
• Peptide Sequence: Synthetic peptide located within the following region: AAPCALENEDICQWNKMKYKSVYKNVILQVPVGLTVHTSLVCSVTLLITI
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PIGX (ARP60842_P050) antibody is Catalog # AAP60842

Target Info

• Gene Symbol: PIGX
• Gene Full Name: Phosphatidylinositol glycan anchor biosynthesis, class X
• Alias Symbols: PIG-X
• NCBI Gene Id: 54965
• Protein Name: HCG40298, isoform CRA_d EMBL EAW53638.1
• Description of Target: This gene encodes a type I transmembrane protein in the endoplasmic reticulum (ER). The protein is an essential component of glycosylphosphatidylinositol-mannosyltransferase I, which transfers the first of the four mannoses in the GPI-anchor precursors during GPI-anchor biosynthesis. Studies in rat indicate that the protein is translated from a non-AUG translation initiation site. Alternative splicing results in multiple transcript variants.
• Uniprot ID: A8MSL3
• Protein Accession #: NP_060331
• Nucleotide Accession #: NM_017861
• Protein Size (# AA): 217
• Molecular Weight: 25kDa
• Protein Interactions: UBC; PIGM;