PECR Antibody - C-terminal region (ARP60839_P050)

Catalog No: ARP60839_P050

WB Suggested Anti-PECR Antibody
Titration: 1.0 ug/ml
Positive Control: HCT15 Whole CellPECR is supported by BioGPS gene expression data to be expressed in HCT15

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Rat, Guinea Pig, Horse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Guinea Pig: 86%; Horse: 86%; Human: 100%; Rat: 86%
• Peptide Sequence: Synthetic peptide located within the following region: ITGQSVDVDGGRSLYTHSYEVPDHDNWPKGAGDLSVVKKMKETFKEKAKL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PECR (ARP60839_P050) antibody is Catalog # AAP60839
• Sample Type Confirmation:

  PECR is supported by BioGPS gene expression data to be expressed in HCT15

Target Info

• Gene Symbol: PECR
• Gene Full Name: Peroxisomal trans-2-enoyl-CoA reductase
• Alias Symbols: TERP, DCRRP, PVIARL, HPDHASE, SDR29C1, HSA250303
• NCBI Gene Id: 55825
• Protein Name: Peroxisomal trans-2-enoyl-CoA reductase
• Description of Target: The function of this protein remains unknown.
• Uniprot ID: Q9BY49
• Protein Accession #: NP_060911
• Nucleotide Accession #: NM_018441
• Protein Size (# AA): 303
• Molecular Weight: 32kDa
• Protein Interactions: PEX5; ISL1;