website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

PAX7 Antibody - C-terminal region (ARP32742_P050)

Description of Target:
PAX7 is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The specific function of the paired box gene 7 is unknown but speculated to involve tumor suppression since fusion of this gene with a forkhead domain family member has been associated with alveolar rhabdomyosarcoma. Alternative splicing in this gene has produced two known products but the biological significance of the variants is unknown.
Gene Symbol:
PAX7
Official Gene Full Name:
Paired box 7
NCBI Gene Id:
5081
Alias Symbols:
FLJ37460; HUP1; PAX7B; RMS2
Tissue Tool:
Find tissues and cell lines supported to express PAX7.
Protein Accession #:
NP_002575
Nucleotide Accession#:
NM_002584
Swissprot Id:
P23759
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Paired box protein Pax-7
Protein Size (# AA):
520
Molecular Weight:
57kDa
Application:
IHC, WB
Partner Proteins:
HIRA,ASH2L,UBC,Ubc,WDR5
Immunogen:
The immunogen for Anti-PAX7 antibody is: synthetic peptide directed towards the C-terminal region of PAX7
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
PAX7 antibody - C-terminal region (ARP32742_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Pig: 93%; Rat: 93%; Mouse: 93%; Rabbit: 93%; Guinea pig: 93%
Species Reactivity:
Bovine, Dog, Horse, Human, Rat, Rabbit, Mouse, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-PAX7 antibody
ARP32742_P050
Peptide Sequence:
Synthetic peptide located within the following region: QADFSISPLHGGLDSATSISASCSQRADSIKPGDSLPTSQAYCPPTYSTT
Blocking Peptide:
For anti-PAX7 antibody is Catalog # AAP32742
Key Reference:
N/A
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-PAX7 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question