website statistics

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

PAX7 Antibody - C-terminal region (ARP32742_P050)

Scroll Horizontally to view all Images
Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
100 ul
$289.00
In Stock
Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
PAX7
NCBI Gene Id:
5081
Official Gene Full Name:
Paired box 7
Protein Name:
Paired box protein Pax-7
Swissprot Id:
P23759
Protein Accession #:
NP_002575
Nucleotide Accession #:
NM_002584
Alias Symbols:
FLJ37460, HUP1, PAX7B, RMS2
Description of Target:
PAX7 is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The specific function of the paired box gene 7 is unknown but speculated to involve tumor suppression since fusion of this gene with a forkhead domain family member has been associated with alveolar rhabdomyosarcoma. Alternative splicing in this gene has produced two known products but the biological significance of the variants is unknown.
Protein Size (# AA):
520
Molecular Weight:
57kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PAX7.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PAX7.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of PAX7
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
Complete computational species homology data:
Anti-PAX7 (ARP32742_P050)
Peptide Sequence:
Synthetic peptide located within the following region: QADFSISPLHGGLDSATSISASCSQRADSIKPGDSLPTSQAYCPPTYSTT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
TRIM27; MYOD1; Dlg4; WDR5; ASH2L; HIRA; Ubc;
Blocking Peptide:
For anti-PAX7 (ARP32742_P050) antibody is Catalog # AAP32742
Datasheets / Downloads:
Printable datasheet for anti-PAX7 (ARP32742_P050) antibody

Product Protocols: PAX7 antibody tested with Human Hepg2 Cells (ARP32742_P050)

Aviva Systems Biology is the original manufacturer of this PAX7 antibody (ARP32742_P050)

Click here to view the PAX7 antibody Western Blot Protocol

Product Datasheet Link: PAX7 antibody (ARP32742_P050)

WB Suggested Anti-PAX7 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2

Western Blot image:


Description of Target: PAX7 is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The specific function of the paired box gene 7 is unknown but speculated to involve tumor suppression since fusion of this gene with a forkhead domain family member has been associated with alveolar rhabdomyosarcoma. Alternative splicing in this gene has produced two known products but the biological significance of the variants is unknown.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s PAX7 antibody (ARP32742_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question