website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

PAX7 Antibody - C-terminal region (ARP32742_P050)

Description of Target:
PAX7 is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The specific function of the paired box gene 7 is unknown but speculated to involve tumor suppression since fusion of this gene with a forkhead domain family member has been associated with alveolar rhabdomyosarcoma. Alternative splicing in this gene has produced two known products but the biological significance of the variants is unknown.
Gene Symbol:
Official Gene Full Name:
Paired box 7
NCBI Gene Id:
Alias Symbols:
FLJ37460; HUP1; PAX7B; RMS2
Tissue Tool:
Find tissues and cell lines supported to express PAX7.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Paired box protein Pax-7
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
The immunogen for Anti-PAX7 antibody is: synthetic peptide directed towards the C-terminal region of PAX7
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
PAX7 antibody - C-terminal region (ARP32742_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Pig: 93%; Rat: 93%; Mouse: 93%; Rabbit: 93%; Guinea pig: 93%
Species Reactivity:
Bovine, Dog, Horse, Human, Rat, Rabbit, Mouse, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-PAX7 antibody
Peptide Sequence:
Synthetic peptide located within the following region: QADFSISPLHGGLDSATSISASCSQRADSIKPGDSLPTSQAYCPPTYSTT
Blocking Peptide:
For anti-PAX7 antibody is Catalog # AAP32742
Target Reference:
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-PAX7 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for PAX7 antibody (ARP32742)

Product page for PAX7 antibody (ARP32742)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant PAX7 antibody; Loxodonta africana PAX7 antibody G3UB47 92%
African elephant PAX7 antibody; Loxodonta africana PAX7 antibody G3T847 92%
Bornean orangutan PAX7 antibody; Pongo pygmaeus PAX7 antibody A2T7V2 100%
Bovine PAX7 antibody; Bos taurus PAX7 antibody E1BKL5 100%
Chicken PAX7 antibody; Gallus gallus PAX7 antibody O42349 78%
Chicken PAX7 antibody; Gallus gallus PAX7 antibody F1NYC8 78%
Chimpanzee PAX7 antibody; Pan troglodytes PAX7 antibody A2T793 100%
Chinese softshell turtle PsPax7 antibody; Pelodiscus sinensis PsPax7 antibody Q2L6R8 78%
Common turkey Pax7 antibody; Meleagris gallopavo Pax7 antibody D2KKK6 78%
Dog PAX7 antibody; Canis familiaris PAX7 antibody F1PNX6 100%
Giant panda PAX7 antibody; Ailuropoda melanoleuca PAX7 antibody G1MFD9 100%
Guinea pig PAX7 antibody; Cavia porcellus PAX7 antibody H0VRC5 92%
Horse PAX7 antibody; Equus caballus PAX7 antibody F6VTJ2 100%
Human PAX7 antibody; Homo sapiens PAX7 antibody P23759 100%
Human PAX7 antibody; Homo sapiens PAX7 antibody P23759-2 100%
Human PAX7 antibody; Homo sapiens PAX7 antibody Q2PJS5 100%
Human PAX7 antibody; Homo sapiens PAX7 antibody E9PFV9 100%
Kloss gibbon PAX7 antibody; Hylobates klossii PAX7 antibody A2D593 100%
Little brown bat PAX7 antibody; Myotis lucifugus PAX7 antibody G1NXF1 92%
Lowland gorilla PAX7 antibody; Gorilla gorilla gorilla PAX7 antibody G3RVQ1 100%
Lowland gorilla PAX7 antibody; Gorilla gorilla gorilla PAX7 antibody G3QNL3 100%
Mouse PAX7 antibody; Mus musculus PAX7 antibody P47239 92%
Mouse Pax7 antibody; Mus musculus Pax7 antibody G3UX36 92%
Mouse Pax7 antibody; Mus musculus Pax7 antibody B1AXW9 92%
Northern white-cheeked gibbon PAX7 antibody; Nomascus leucogenys PAX7 antibody G1R8G8 100%
Rabbit PAX7 antibody; Oryctolagus cuniculus PAX7 antibody G1U601 92%
Rabbit PAX7 antibody; Oryctolagus cuniculus PAX7 antibody G1SQF4 92%
Rat Pax7 antibody; Rattus norvegicus Pax7 antibody D3ZRA8 92%
Red-chested mustached tamarin PAX7 antibody; Saguinus labiatus PAX7 antibody A1YFN7 92%
Rhesus macaque LOC702013 antibody; Macaca mulatta LOC702013 antibody F7HMI2 100%
Small-eared galago PAX7 antibody; Otolemur garnettii PAX7 antibody H0XF84 100%
Tasmanian devil PAX7 antibody; Sarcophilus harrisii PAX7 antibody G3VSS7 85%
White-tufted-ear marmoset LOC100406841 antibody; Callithrix jacchus LOC100406841 antibody F7I2L5 92%
White-tufted-ear marmoset LOC100406841 antibody; Callithrix jacchus LOC100406841 antibody F7H4A6 92%

Product Protocols: PAX7 antibody tested with Human Hepg2 Cells (ARP32742_P050)

Aviva Systems Biology is the original manufacturer of this PAX7 antibody (ARP32742_P050)

Click here to view the PAX7 antibody Western Blot Protocol

Product Datasheet Link: PAX7 antibody (ARP32742_P050)

WB Suggested Anti-PAX7 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2

Western Blot image:

Description of Target: PAX7 is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The specific function of the paired box gene 7 is unknown but speculated to involve tumor suppression since fusion of this gene with a forkhead domain family member has been associated with alveolar rhabdomyosarcoma. Alternative splicing in this gene has produced two known products but the biological significance of the variants is unknown.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s PAX7 antibody (ARP32742_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question