PAX7 Antibody - C-terminal region (ARP32742_P050)

Catalog#: ARP32742_P050

• Size: 50ug

Human HepG2

Mouse

• Description of Target: PAX7 is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The specific function of the paired box gene 7 is unknown but speculated to involve tumor suppression since fusion of this gene with a forkhead domain family member has been associated with alveolar rhabdomyosarcoma. Alternative splicing in this gene has produced two known products but the biological significance of the variants is unknown.
• Gene Symbol: PAX7
• Official Gene Full Name: Paired box 7
• Alias Symbols: FLJ37460; HUP1; PAX7B; RMS2
• Protein Accession#: NP_002575
• Nucleotide Accession#: NM_002584
• Swissprot Id: P23759
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 520
• Molecular Weight: 57kDa
• Application: WB
• Partner Proteins: HIRA,ASH2L,UBC,Ubc,WDR5
• Immunogen: The immunogen for Anti-PAX7 antibody is: synthetic peptide directed towards the C-terminal region of PAX7
• Product Format: Lyophilized powder
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Bovine: 100%; Dog: 100%; Horse: 100%; Human: 100%; Guinea pig: 92%; Mouse: 92%; Rabbit: 92%; Rat: 92%; Chicken: 78%
• Peptide Sequence: Synthetic peptide located within the following region: QADFSISPLHGGLDSATSISASCSQRADSIKPGDSLPTSQAYCPPTYSTT
• Blocking Peptide: For anti-PAX7 antibody is Catalog # AAP32742
• Key Reference: N/A
• Reconstitution and Storage: Add 50 μl of distilled water. Final antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: PAX7 antibody tested with Human Hepg2 Cells (ARP32742_P050)

Aviva Systems Biology is the original manufacturer of this PAX7 antibody (ARP32742_P050)

Click here to view the PAX7 antibody Western Blot Protocol

Product Datasheet Link: PAX7 antibody (ARP32742_P050)

WB Suggested Anti-PAX7 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2

Western Blot image:


Description of Target: PAX7 is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The specific function of the paired box gene 7 is unknown but speculated to involve tumor suppression since fusion of this gene with a forkhead domain family member has been associated with alveolar rhabdomyosarcoma. Alternative splicing in this gene has produced two known products but the biological significance of the variants is unknown.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s PAX7 antibody (ARP32742_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

Product Review: PAX7 Antibody - C-terminal region (ARP32742_P050) in Mouse tibialis anterior muscle using IHC

Product page for PAX7 Antibody - C-terminal region (ARP32742_P050)

Researcher:Dr Didier Montarras, Institut Pasteur
Application: IHC
Species+tissue/cell type: Mouse tibialis anterior muscle
Primary antibody dilution: 1:500
Secondary antibody: Goat anti-rabbit Alexa Fluor 546
Secondary antibody dilution: 1:300