PANK2 Antibody - C-terminal region (ARP63794_P050)

Catalog No: ARP63794_P050

Host: Rabbit
Target Name: PANK2
Sample Type: HepG2 Whole cell lysates
Antibody Dilution: 1.0ug/mlPANK2 is supported by BioGPS gene expression data to be expressed in HepG2

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human PANK2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 86%
• Peptide Sequence: Synthetic peptide located within the following region: FEEALEMASRGDSTKVDKLVRDIYGGDYERFGLPGWAVASSFGNMMSKEK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PANK2 (ARP63794_P050) antibody is Catalog # AAP63794
• Sample Type Confirmation:

  PANK2 is supported by BioGPS gene expression data to be expressed in HepG2

Target Info

• Gene Symbol: PANK2
• Gene Full Name: pantothenate kinase 2
• Alias Symbols: HSS, HARP, PKAN, NBIA1, C20orf48
• NCBI Gene Id: 80025
• Protein Name: Pantothenate kinase 2, mitochondrial
• Description of Target: This gene encodes a protein belonging to the pantothenate kinase family and is the only member of that family to be expressed in mitochondria. Pantothenate kinase is a key regulatory enzyme in the biosynthesis of coenzyme A (CoA) in bacteria and mammalian cells. It catalyzes the first committed step in the universal biosynthetic pathway leading to CoA and is itself subject to regulation through feedback inhibition by acyl CoA species. Mutations in this gene are associated with HARP syndrome and pantothenate kinase-associated neurodegeneration (PKAN), formerly Hallervorden-Spatz syndrome. Alternative splicing, involving the use of alternate first exons, results in multiple transcripts encoding different isoforms.
• Uniprot ID: Q9BZ23-3
• Protein Size (# AA): 447
• Molecular Weight: 49kDa
• Protein Interactions: UBC; DHX36; QRICH2; LXN; YWHAQ; VDAC1; RASGRF2;