- Description of Target:
- This gene was identified by involvement in some t(X;14) translocations associated with mature T-cell proliferations. This region has a complex gene structure, with a common promoter and 5' exon spliced to two different sets of 3' exons that encode two different proteins. This gene represents the downstream 8 kDa protein that localizes to mitochondria.
- Gene Symbol:
- MTCP1NB
- Official Gene Full Name:
- Mature T-cell proliferation 1 neighbor
- Alias Symbols:
- C6.1B; MGC2069; MTCP1; p8; p8MTCP1
- Tissue Tool:
- Find tissues and cell lines supported to express MTCP1NB.
- Protein Accession# :
- NP_001018024
- Nucleotide Accession#:
- NM_001018024
- Swissprot Id:
- P56277
- Host:
- Rabbit
- Protein Size (# AA):
- 68
- Molecular Weight:
- 8kDa
- Application:
- WB
- Product Format:
- Lyophilized powder
- Complete computational species homology data:
- MTCP1NB antibody - N-terminal region (ARP30860_P050)
- Datasheets / Downloads:
- Printable datasheet for
anti-MTCP1NB antibody
- ARP30860_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: KCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKS
- Blocking Peptide:
- For anti-MTCP1NB antibody is Catalog # AAP30860
- Key Reference:
- N/A
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-MTCP1NB antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
