MRPS18C Antibody - C-terminal region (ARP70893_P050)

Catalog No: ARP70893_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

Host: Rabbit
Target Name: MRPS18C
Sample Type: MCF7 Whole Cell lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Guinea Pig, Horse, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human MRPS18C
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rat: 93%; Zebrafish: 83%
• Peptide Sequence: Synthetic peptide located within the following region: FVSPFTGCIYGRHITGLCGKKQKEITKAIKRAQIMGFMPVTYKDPAYLKD
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-MRPS18C (ARP70893_P050) antibody is Catalog # AAP70893

Target Info

• Gene Symbol: MRPS18C
• Alias Symbols: CGI-134, S18mt-c, MRPS18-1, mrps18-c, MRP-S18-1, MRP-S18-c
• NCBI Gene Id: 51023
• Protein Name: 28S ribosomal protein S18c, mitochondrial
• Description of Target: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S18P family. The encoded protein is one of three that has significant sequence similarity to bacterial S18 proteins.
• Uniprot ID: Q9Y3D5
• Protein Accession #: NP_057151
• Nucleotide Accession #: NM_016067
• Protein Size (# AA): 142
• Molecular Weight: 15kDa
• Protein Interactions: LIG4; UBC;