KMO Antibody - N-terminal region (ARP64019_P050)

Catalog No: ARP64019_P050

Host: Rabbit
Target Name: KMO
Sample Type: 293T Whole Cell lysates
Antibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that KMO is expressed in HEK293T

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human KMO
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 79%; Rabbit: 85%; Rat: 86%
• Peptide Sequence: Synthetic peptide located within the following region: RLLKCNPEEGMITVLGSDKVPKDVTCDLIVGCDGAYSTVRSHLMKKPRFD
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-KMO (ARP64019_P050) antibody is Catalog # AAP64019
• Sample Type Confirmation:

  There is BioGPS gene expression data showing that KMO is expressed in HEK293T

Target Info

• Gene Symbol: KMO
• Gene Full Name: kynurenine 3-monooxygenase (kynurenine 3-hydroxylase)
• Alias Symbols: dJ317G22.1
• NCBI Gene Id: 8564
• Protein Name: Kynurenine 3-monooxygenase
• Description of Target: This gene encodes a mitochondrion outer membrane protein that catalyzes the hydroxylation of L-tryptophan metabolite, L-kynurenine, to form L-3-hydroxykynurenine. Studies in yeast identified this gene as a therapeutic target for Huntington disease.
• Uniprot ID: O15229-3
• Protein Size (# AA): 452
• Molecular Weight: 49kDa