IDE Antibody - N-terminal region (ARP30652_P050)

Catalog No: ARP30652_P050

WB Suggested Anti-IDE Antibody
Titration: 1.0 ug/ml
Positive Control: Hela Whole CellIDE is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
• Peptide Sequence: Synthetic peptide located within the following region: LDVHIGSLSDPPNIAGLSHFCEHMLFLGTKKYPKENEYSQFLSEHAGSSN
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-IDE (ARP30652_P050) antibody is Catalog # AAP30652 (Previous Catalog # AAPP01309)
• Sample Type Confirmation:

  IDE is strongly supported by BioGPS gene expression data to be expressed in HeLa

Target Info

• Gene Symbol: IDE
• Gene Full Name: Insulin-degrading enzyme
• Alias Symbols: INSULYSIN
• NCBI Gene Id: 3416
• Protein Name: Insulin-degrading enzyme
• Description of Target: This gene encodes a zinc metallopeptidase that degrades intracellular insulin, and thereby terminates insulins activity, as well as participating in intercellular peptide signalling by degrading diverse peptides such as glucagon, amylin, bradykinin, and kallidin. The preferential affinity of this enzyme for insulin results in insulin-mediated inhibition of the degradation of other peptides such as beta-amyloid. Deficiencies in this protein's function are associated with Alzheimer's disease and type 2 diabetes mellitus but mutations in this gene have not been shown to be causitive for these diseases. This protein localizes primarily to the cytoplasm but in some cell types localizes to the extracellular space, cell membrane, peroxisome, and mitochondrion.
• Uniprot ID: P14735
• Protein Accession #: NP_004960
• Nucleotide Accession #: NM_004969
• Protein Size (# AA): 1019
• Molecular Weight: 118kDa
• Protein Interactions: UBC; DCP2; SUMO1; NEDD8; PUS1; TBC1D15; PUS7; ARFIP1; GSPT2; PRMT3; STAT1; SHMT2; SHMT1; PAWR; GSPT1; CTTN; CARS; ATP6V1C1; PEX5; IFIH1; Cdk1; UCHL5; SIRT4; AR; INS; IGF2; IGF1; NR3C1; APP; ZHX2;