FASLG antibody - middle region (ARP30633_P050)

Catalog#: ARP30633_P050

• Size: 50ug

Human HeLa

• Description of Target: TNFSF6 is a cytokine that binds to TNFRSF6/FAS, a receptor that transduces the apoptotic signal into cells. May be involved in cytotoxic T cell mediated apoptosis and in T cell development. TNFRSF6/FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T cells, or both. Binding to the decoy receptor TNFRSF6B/DcR3 modulates its effects.
• Gene Symbol: FASLG
• Official Gene Full Name: Fas ligand (TNF superfamily, member 6)
• Alias Symbols: APT1LG1; CD178; CD95L; FASL; TNFSF6; CD95-L
• Protein Accession#: NP_000630
• Nucleotide Accession#: NM_000639
• Swissprot Id: P48023
• Host: Rabbit
• Protein Size (# AA): 281
• Molecular Weight: 31kDa
• Application: WB
• Partner Proteins: EGR2,EGR3,FNBP1,GRB2,PACSIN2,APBB1,DAXX,DMD,EZR,FADD,FAS,FN1,FNBP1,FYN,GRAP,GRAP2,GRB2,LCK,MLL,MMP7,NCF1,NCK1,PACSIN2,PDCD6,PIK3R1,PIN1,PRPF40A,PSTPIP1,PTPN13,SRC,SUMO1,TNFRSF6B,ARHGDIA,BID,CASP10,CASP8,EZR,FADD,FAS,FGR,FN1,FNBP1,FYN,GRAP,GRAP2,GRB2,LCK,LYN,MAPK8,MMP7,MSN,NCK1,PACSIN2,PTPN13,RHOA,SUMO1,TNFRSF10B,TNFRSF1A,TNFRSF6B,UBC
• Product Format: Lyophilized powder
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Bovine: 85%; Horse: 78%
• Peptide Sequence: Synthetic peptide located within the following region: MHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVL
• Blocking Peptide: For anti-FASLG antibody is Catalog # AAP30633
• Key Reference: N/A
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-FASLG antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.