DGUOK Antibody - C-terminal region (ARP64409_P050)

Catalog No: ARP64409_P050

WB Suggested Anti-DGUOK Antibody
Titration: 1.0 ug/ml
Positive Control: 721_B Whole CellDGUOK is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human DGUOK
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 93%; Guinea Pig: 79%; Horse: 79%; Human: 100%; Pig: 86%; Rabbit: 86%; Rat: 85%
• Peptide Sequence: Synthetic peptide located within the following region: EQLHGQHEAWLIHKTTKLHFEALMNIPVLVLDVNDDFSEEVTKQEDLMRE
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-DGUOK (ARP64409_P050) antibody is Catalog # AAP64409
• Sample Type Confirmation:

  DGUOK is strongly supported by BioGPS gene expression data to be expressed in 721_B

Target Info

• Gene Symbol: DGUOK
• Alias Symbols: dGK, NCPH, PEOB4, MTDPS3
• NCBI Gene Id: 1716
• Protein Name: Deoxyguanosine kinase, mitochondrial
• Description of Target: In mammalian cells, the phosphorylation of purine deoxyribonucleosides is mediated predominantly by two deoxyribonucleoside kinases, cytosolic deoxycytidine kinase and mitochondrial deoxyguanosine kinase. The protein encoded by this gene is responsible for phosphorylation of purine deoxyribonucleosides in the mitochondrial matrix. In addition, this protein phosphorylates several purine deoxyribonucleoside analogs used in the treatment of lymphoproliferative disorders, and this phosphorylation is critical for the effectiveness of the analogs. Alternative splice variants encoding different protein isoforms have been described for this gene.
• Uniprot ID: Q16854
• Protein Accession #: NP_550438
• Nucleotide Accession #: NM_080916
• Protein Size (# AA): 277
• Molecular Weight: 28kDa
• Protein Interactions: UBC; PXN; LIG4; APP; DGUOK;