SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP38516_P050
Price: $0.00
SKU
ARP38516_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-Ciao1 (ARP38516_P050) antibody
Product Info
Tested Species ReactivityMouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Ciao1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 79%; Dog: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 79%; Rabbit: 93%; Rat: 100%; Zebrafish: 86%
Peptide SequenceSynthetic peptide located within the following region: MKDSLVLQSRVPAHPDSRCWFLAWNPSGTLLASCGGDRKIRIWGTEGDSW
Concentration0.5 mg/ml
Blocking PeptideFor anti-Ciao1 (ARP38516_P050) antibody is Catalog # AAP38516
Gene SymbolCiao1
Alias SymbolsWdr3, Wdr39, AW210570
NCBI Gene Id26371
Protein NameProbable cytosolic iron-sulfur protein assembly protein CIAO1
Description of TargetCiao1 is an essential component of the cytosolic iron-sulfur (Fe/S) protein assembly machinery. It is required for the maturation of extramitochondrial Fe/S proteins. Seems to specifically modulate the transactivation activity of WT1. As part of the mitotic spindle-associated MMXD complex it may play a role in chromosome segregation.
Uniprot IDQ99KN2
Protein Accession #NP_079572
Nucleotide Accession #NM_025296
Protein Size (# AA)339
Molecular Weight38kDa
Protein InteractionsIqcb1;
  1. What is the species homology for "Ciao1 Antibody - N-terminal region (ARP38516_P050)"?

    The tested species reactivity for this item is "Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Zebrafish".

  2. How long will it take to receive "Ciao1 Antibody - N-terminal region (ARP38516_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Ciao1 Antibody - N-terminal region (ARP38516_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Ciao1 Antibody - N-terminal region (ARP38516_P050)"?

    This target may also be called "Wdr3, Wdr39, AW210570" in publications.

  5. What is the shipping cost for "Ciao1 Antibody - N-terminal region (ARP38516_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Ciao1 Antibody - N-terminal region (ARP38516_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Ciao1 Antibody - N-terminal region (ARP38516_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "38kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Ciao1 Antibody - N-terminal region (ARP38516_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CIAO1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CIAO1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CIAO1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CIAO1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CIAO1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CIAO1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Ciao1 Antibody - N-terminal region (ARP38516_P050)
Your Rating
We found other products you might like!