IDE antibody - N-terminal region (ARP30652_P050)

Catalog#: ARP30652_P050

• Size: 50ug

Human HeLa

• Description of Target: This gene encodes a zinc metallopeptidase that degrades intracellular insulin, and thereby terminates insulins activity, as well as participating in intercellular peptide signalling by degrading diverse peptides such as glucagon, amylin, bradykinin, and kallidin. The preferential affinity of this enzyme for insulin results in insulin-mediated inhibition of the degradation of other peptides such as beta-amyloid. Deficiencies in this protein's function are associated with Alzheimer's disease and type 2 diabetes mellitus but mutations in this gene have not been shown to be causitive for these diseases. This protein localizes primarily to the cytoplasm but in some cell types localizes to the extracellular space, cell membrane, peroxisome, and mitochondrion.
• Gene Symbol: IDE
• Official Gene Full Name: Insulin-degrading enzyme
• Alias Symbols: FLJ35968; INSULYSIN
• Protein Accession#: NP_004960
• Nucleotide Accession#: NM_004969
• Swissprot Id: P14735
• Host: Rabbit
• Protein Size (# AA): 1019
• Molecular Weight: 118kDa
• Application: WB
• Partner Proteins: APP,AR,IGF1,IGF2,INS,NR3C1,IGF1,IGF2,ZHX2
• Product Format: Lyophilized powder
• Predicted Homology Based on Immunogen Sequence: Bovine: 100%; Dog: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Mouse: 92%; Rat: 92%; Zebrafish: 78%
• Peptide Sequence: Synthetic peptide located within the following region: LDVHIGSLSDPPNIAGLSHFCEHMLFLGTKKYPKENEYSQFLSEHAGSSN
• Blocking Peptide: For anti-IDE antibody is Catalog # AAP30652 (Previous Catalog # AAPP01309)
• Key Reference: N/A
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-IDE antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.