SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP41845_P050
Price: $0.00
SKU
ARP41845_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

ALAD Antibody - N-terminal region (ARP41845_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-ALAD (ARP41845_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ALAD
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Peptide SequenceSynthetic peptide located within the following region: MPPTSSTPSLSRPGLGQAGKPDTGSHPPPTISTSIFLSCFPTIPLSRPRT
Concentration0.5 mg/ml
Blocking PeptideFor anti-ALAD (ARP41845_P050) antibody is Catalog # AAP41845 (Previous Catalog # AAPP10893)
Gene SymbolALAD
Gene Full NameAminolevulinate dehydratase
Alias SymbolsPBGS, ALADH
NCBI Gene Id210
Description of TargetThe ALAD enzyme is composed of 8 identical subunits and catalyzes the condensation of 2 molecules of delta-aminolevulinate to form porphobilinogen (a precursor of heme, cytochromes and other hemoproteins). ALAD catalyzes the second step in the porphyrin and heme biosynthetic pathway; zinc is essential for enzymatic activity. ALAD enzymatic activity is inhibited by lead and a defect in the ALAD structural gene can cause increased sensitivity to lead poisoning and acute hepatic porphyria.
Uniprot IDP13716
Protein Accession #NP_001003945
Nucleotide Accession #NM_001003945
Protein Size (# AA)359
Molecular Weight39kDa
Protein InteractionsC14orf142; P3H1; RPRD1B; PPME1; LAP3; DBNL; HSPBP1; GPN1; WDR4; ACTR2; TOM1L1; ZPR1; OGT; SURF2; LPP; AGFG1; UBD; UBC; ALAD;
  1. What is the species homology for "ALAD Antibody - N-terminal region (ARP41845_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "ALAD Antibody - N-terminal region (ARP41845_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ALAD Antibody - N-terminal region (ARP41845_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ALAD Antibody - N-terminal region (ARP41845_P050)"?

    This target may also be called "PBGS, ALADH" in publications.

  5. What is the shipping cost for "ALAD Antibody - N-terminal region (ARP41845_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ALAD Antibody - N-terminal region (ARP41845_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ALAD Antibody - N-terminal region (ARP41845_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "39kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ALAD Antibody - N-terminal region (ARP41845_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ALAD"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ALAD"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ALAD"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ALAD"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ALAD"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ALAD"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ALAD Antibody - N-terminal region (ARP41845_P050)
Your Rating
We found other products you might like!