UNC13D Antibody - C-terminal region (ARP64215_P050)

Catalog No: ARP64215_P050

Host: Rabbit
Target Name: UNC13D
Sample Type: Fetal Lung lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human UNC13D
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 93%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 92%; Rabbit: 86%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: SGSEEPGEVPQTRLPLTYPAPNGDPILQLLEGRKGDREAQVFVRLRRHRA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-UNC13D (ARP64215_P050) antibody is Catalog # AAP64215

Target Info

• Gene Symbol: UNC13D
• Gene Full Name: unc-13 homolog D (C. elegans)
• Alias Symbols: FHL3, HLH3, HPLH3, Munc13-4
• NCBI Gene Id: 201294
• Protein Name: Protein unc-13 homolog D
• Description of Target: This gene encodes a protein that is a member of the UNC13 family, containing similar domain structure as other family members but lacking an N-terminal phorbol ester-binding C1 domain present in other Munc13 proteins. The protein appears to play a role in vesicle maturation during exocytosis and is involved in regulation of cytolytic granules secretion. Mutations in this gene are associated with familial hemophagocytic lymphohistiocytosis type 3, a genetically heterogeneous, rare autosomal recessive disorder.
• Uniprot ID: Q70J99
• Protein Accession #: NP_954712
• Nucleotide Accession #: NM_199242
• Protein Size (# AA): 1090
• Molecular Weight: 119kDa
• Protein Interactions: UBC; CUL5; VPS37B; XRN2; LMNA; RAB27B; RAB27A;