Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any help please email info@avivasysbio.com

Catalog No: ARP54389_P050
Price: $0.00
SKU
ARP54389_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

TXLNG Antibody - N-terminal region (ARP54389_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-TXLNG (ARP54389_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human TXLNG
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 85%; Dog: 86%; Horse: 79%; Human: 100%; Mouse: 75%; Pig: 77%; Rabbit: 86%; Rat: 93%
Peptide SequenceSynthetic peptide located within the following region: KADMLCNSQSNDILQHQGSNCGGTSNKHSLEEDEGSDFITENRNLVSPAY
Concentration0.5 mg/ml
Blocking PeptideFor anti-TXLNG (ARP54389_P050) antibody is Catalog # AAP54389
Gene SymbolTXLNG
Alias SymbolsELRG, FIAT, LSR5, TXLNGX, CXorf15
NCBI Gene Id55787
Protein NameGamma-taxilin
Description of TargetThis gene encodes a member of the taxilin family. The encoded protein binds to the C-terminal coiled-coil region of syntaxin family members 1A, 3A and 4A, and may play a role in intracellular vesicle trafficking. This gene is up-regulated by lipopolysaccharide and the gene product may be involved in cell cycle regulation. The related mouse protein was also shown to inhibit activating transcription factor 4-mediated transcription and thus regulate bone mass accrual. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Uniprot IDQ9NUQ3
Protein Accession #NP_060830
Nucleotide Accession #NM_018360
Protein Size (# AA)528
Molecular Weight58kDa
Protein InteractionsSTUB1; UBC; USP3; ZC3H11A; UBA1; TTC4; TLN1; CHAMP1; TXLNA; WIPF2; TXLNB; AZI2; TBK1; MAX; STX4;
  1. What is the species homology for "TXLNG Antibody - N-terminal region (ARP54389_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit".

  2. How long will it take to receive "TXLNG Antibody - N-terminal region (ARP54389_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TXLNG Antibody - N-terminal region (ARP54389_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TXLNG Antibody - N-terminal region (ARP54389_P050)"?

    This target may also be called "ELRG, FIAT, LSR5, TXLNGX, CXorf15" in publications.

  5. What is the shipping cost for "TXLNG Antibody - N-terminal region (ARP54389_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TXLNG Antibody - N-terminal region (ARP54389_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TXLNG Antibody - N-terminal region (ARP54389_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "58kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TXLNG Antibody - N-terminal region (ARP54389_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TXLNG"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TXLNG"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TXLNG"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TXLNG"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TXLNG"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TXLNG"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TXLNG Antibody - N-terminal region (ARP54389_P050)
Your Rating
We found other products you might like!