SYTL5 Antibody - middle region (ARP66696_P050)

Catalog No: ARP66696_P050

WB Suggested Anti-SYTL5 Antibody
Titration: 1.0 ug/ml
Positive Control: HepG2 Whole Cell

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Rat, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human SYTL5
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Horse: 93%; Human: 100%; Pig: 92%; Rabbit: 86%; Rat: 93%
• Peptide Sequence: Synthetic peptide located within the following region: PGAEEVQSQEQTRQDAEKSDTSPVAGKKASHDGPKRKGFLLSKFRSATRG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SYTL5 (ARP66696_P050) antibody is Catalog # AAP66696

Target Info

• Gene Symbol: SYTL5
• Alias Symbols: slp5
• NCBI Gene Id: 94122
• Protein Name: Synaptotagmin-like protein 5
• Description of Target: The protein encoded by this gene belongs to the synaptotagmin-like (Slp) protein family, which contains a unique homology domain at the N-terminus, referred to as the Slp homology domain (SHD). The SHD functions as a binding site for Rab27A, which plays a role in protein transport. Expression of this gene is restricted to placenta and liver, suggesting that it might be involved in Rab27A-dependent membrane trafficking in specific tissues. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Uniprot ID: Q8TDW5
• Protein Accession #: EAW59450
• Nucleotide Accession #: NM_001163334
• Protein Size (# AA): 921
• Molecular Weight: 102kDa
• Protein Interactions: CEP70; WAC; RAB27B; RAB27A; RAB6A; RAB3A;