PCDH1 Antibody - N-terminal region (ARP45331_P050)

Catalog No: ARP45331_P050

WB Suggested Anti-PCDH1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7 cell lysate

PCDH1 antibody - N-terminal region (ARP45331_P050) validated by WB using bronchial epithelial cell line (16HBE)

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB, ICC
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PCDH1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
• Peptide Sequence: Synthetic peptide located within the following region: LLPSMLLALLLLLAPSPGHATRVVYKVPEEQPPNTLIGSLAADYGFPDVG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PCDH1 (ARP45331_P050) antibody is Catalog # AAP45331 (Previous Catalog # AAPP26307)
• Reference: Rush,J., (2005) Nat. Biotechnol. 23 (1), 94-101

Target Info

• Gene Symbol: PCDH1
• Gene Full Name: Protocadherin 1
• Alias Symbols: PC42, PCDH42
• NCBI Gene Id: 5097
• Protein Name: Protocadherin-1
• Description of Target: PCDH1 belongs to the protocadherin subfamily within the cadherin superfamily. It is a membrane protein found at cell-cell boundaries. It is involved in neural cell adhesion, suggesting a possible role in neuronal development. The protein includes an extracelllular region, containing 7 cadherin-like domains, a transmembrane region and a C-terminal cytoplasmic region. Cells expressing the protein showed cell aggregation activity.This gene belongs to the protocadherin subfamily within the cadherin superfamily. The encoded protein is a membrane protein found at cell-cell boundaries. It is involved in neural cell adhesion, suggesting a possible role in neuronal development. The protein includes an extracelllular region, containing 7 cadherin-like domains, a transmembrane region and a C-terminal cytoplasmic region. Cells expressing the protein showed cell aggregation activity. Alternative splicing occurs in this gene.
• Uniprot ID: Q08174
• Protein Accession #: NP_002578
• Nucleotide Accession #: NM_002587
• Protein Size (# AA): 1060
• Molecular Weight: 111kDa
• Protein Interactions: UBC; SMAD3; ALB; VKORC1; ATF7IP;