NAGPA Antibody - N-terminal region (ARP47241_P050)

Catalog No: ARP47241_P050

Host: Rabbit
Target Name: NAGPA
Sample Type: OVCAR-3 Whole Cell lysates
Antibody Dilution: 1.0ug/ml

Host: Rabbit
Target Name: NAGPA
Sample Tissue: Human HT1080 Whole Cell
Antibody Dilution: 3ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human NAGPA
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 86%
• Peptide Sequence: Synthetic peptide located within the following region: GECLGNVVSDERRVSSSGGLQNAQFGIRRDGTLVTGYLSEEEVLDTENPF
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-NAGPA (ARP47241_P050) antibody is Catalog # AAP47241

Target Info

• Gene Symbol: NAGPA
• Gene Full Name: N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase
• Alias Symbols: UCE, APAA
• NCBI Gene Id: 51172
• Protein Name: N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase
• Description of Target: Hydrolases are transported to lysosomes after binding to mannose 6-phosphate receptors in the trans-Golgi network. This gene encodes the enzyme that catalyzes the second step in the formation of the mannose 6-phosphate recognition marker on lysosomal hydrolases. Commonly known as 'uncovering enzyme' or UCE, this enzyme removes N-acetyl-D-glucosamine (GlcNAc) residues from GlcNAc-alpha-P-mannose moieties and thereby produces the recognition marker. This reaction most likely occurs in the trans-Golgi network. This enzyme functions as a homotetramer of two disulfide-linked homodimers. In addition to having an N-terminal signal peptide, the protein's C-terminus contains multiple signals for trafficking it between lysosomes, the plasma membrane, and trans-Golgi network.
• Uniprot ID: Q9UK23
• Protein Accession #: NP_057340
• Nucleotide Accession #: NM_016256
• Protein Size (# AA): 515
• Molecular Weight: 53kDa
• Protein Interactions: ZHX2; DEGS1; NAGPA; EPS15; AP2A1; FURIN;