Catalog No: ARP45280_P050
Price: $0.00
SKU
ARP45280_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-LTB (ARP45280_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human LTB
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceGuinea Pig: 79%; Horse: 91%; Human: 100%; Rabbit: 100%
Peptide SequenceSynthetic peptide located within the following region: AVPITVLAVLALVPQDQGGLVTETADPGAQAQQGLGFQKLPEEEPETDLS
Concentration0.5 mg/ml
Blocking PeptideFor anti-LTB (ARP45280_P050) antibody is Catalog # AAP45280 (Previous Catalog # AAPP26261)
Gene SymbolLTB
Gene Full NameLymphotoxin beta (TNF superfamily, member 3)
Alias Symbolsp33, TNFC, TNFSF3, TNLG1C
NCBI Gene Id4050
Protein NameLymphotoxin-beta
Description of TargetLymphotoxin beta is a type II membrane protein of the TNF family. It anchors lymphotoxin-alpha to the cell surface through heterotrimer formation. The predominant form on the lymphocyte surface is the lymphotoxin-alpha 1/beta 2 complex (e.g. 1 molecule alpha/2 molecules beta) and this complex is the primary ligand for the lymphotoxin-beta receptor. The minor complex is lymphotoxin-alpha 2/beta 1. LTB is an inducer of the inflammatory response system and involved in normal development of lymphoid tissue. Lymphotoxin-beta isoform b is unable to complex with lymphotoxin-alpha suggesting a function for lymphotoxin-beta which is independent of lympyhotoxin-alpha. Alternative splicing results in multiple transcript variants encoding different isoforms.
Uniprot IDQ06643
Protein Accession #NP_002332
Nucleotide Accession #NM_002341
Protein Size (# AA)244
Molecular Weight25kDa
Protein InteractionsTNFSF14; LTBR; LTB; TNFRSF1A; LTA;
  1. What is the species homology for "LTB Antibody - N-terminal region (ARP45280_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "LTB Antibody - N-terminal region (ARP45280_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "LTB Antibody - N-terminal region (ARP45280_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "LTB Antibody - N-terminal region (ARP45280_P050)"?

    This target may also be called "p33, TNFC, TNFSF3, TNLG1C" in publications.

  5. What is the shipping cost for "LTB Antibody - N-terminal region (ARP45280_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "LTB Antibody - N-terminal region (ARP45280_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "LTB Antibody - N-terminal region (ARP45280_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "25kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "LTB Antibody - N-terminal region (ARP45280_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "LTB"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "LTB"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "LTB"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "LTB"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "LTB"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "LTB"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:LTB Antibody - N-terminal region (ARP45280_P050)
Your Rating
We found other products you might like!