LDLR Antibody - C-terminal region (ARP44305_P050)

Catalog No: ARP44305_P050

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. The protein may be modified by glycosylation.

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human LDLR
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 93%
• Peptide Sequence: Synthetic peptide located within the following region: VDSKLHSISSIDVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-LDLR (ARP44305_P050) antibody is Catalog # AAP44305
• Enhanced Validation:

  Relative Expression (Western Blot)

Target Info

• Gene Symbol: LDLR
• Gene Full Name: low density lipoprotein receptor
• Alias Symbols: FH, FHC, FHCL1, LDLCQ2
• NCBI Gene Id: 3949
• Protein Name: low-density lipoprotein receptor
• Description of Target: The low density lipoprotein receptor (LDLR) gene family consists of cell surface proteins involved in receptor-mediated endocytosis of specific ligands. Low density lipoprotein (LDL) is normally bound at the cell membrane and taken into the cell ending up in lysosomes where the protein is degraded and the cholesterol is made available for repression of microsomal enzyme 3-hydroxy-3-methylglutaryl coenzyme A (HMG CoA) reductase, the rate-limiting step in cholesterol synthesis. At the same time, a reciprocal stimulation of cholesterol ester synthesis takes place. Mutations in this gene cause the autosomal dominant disorder, familial hypercholesterolemia. Alternate splicing results in multiple transcript variants.
• Uniprot ID: P01130-2
• Protein Accession #: NP_001182732
• Nucleotide Accession #: NM_001195803
• Protein Size (# AA): 682
• Molecular Weight: 95 kDa
• Protein Interactions: PCSK9; UBC; env; MAP4; PDIA3; CREBBP; PDIA4; HSP90B1; HSPA5; CANX; MYLIP; AP1M2; LDLR; SNX17; LDLRAP1; DAB1; PF4; APOE; APOB; LRPAP1; DAB2; CD36;