KCNJ4 Antibody - middle region (ARP35167_P050)

Catalog No: ARP35167_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-KCNJ4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 293T cell lysateKCNJ4 is supported by BioGPS gene expression data to be expressed in HEK293T

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Guinea Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KCNJ4
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: AVAAGLGLEAGSKEEAGIIRMLEFGSHLDLERMQASLPLDNISYRRESAI
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-KCNJ4 (ARP35167_P050) antibody is Catalog # AAP35167 (Previous Catalog # AAPP06402)
• Sample Type Confirmation:

  KCNJ4 is supported by BioGPS gene expression data to be expressed in HEK293T

• Reference: Ji,W., (2008) Nat. Genet. 40 (5), 592-599

Target Info

• Gene Symbol: KCNJ4
• Gene Full Name: Potassium inwardly-rectifying channel, subfamily J, member 4
• Alias Symbols: HIR, HRK1, IRK3, HIRK2, IRK-3, Kir2.3
• NCBI Gene Id: 3761
• Protein Name: Inward rectifier potassium channel 4
• Description of Target: KCNJ4 is an integral membrane protein and member of the inward rectifier potassium channel family. The encoded protein has a small unitary conductance compared to other members of this protein family. Two transcript variants encoding the same protein have??een found for this gene. Several different potassium channels are known to be involved with electrical signaling in the nervous system. One class is activated by depolarization whereas a second class is not. The latter are referred to as inwardly rectifying K+ channels, and they have a greater tendency to allow potassium to flow into the cell rather than out of it. This asymmetry in potassium ion conductance plays a key role in the excitability of muscle cells and neuronsSeveral different potassium channels are known to be involved with electrical signaling in the nervous system. One class is activated by depolarization whereas a second class is not. The latter are referred to as inwardly rectifying K+ channels, and they have a greater tendency to allow potassium to flow into the cell rather than out of it. This asymmetry in potassium ion conductance plays a key role in the excitability of muscle cells and neurons. The protein encoded by this gene is an integral membrane protein and member of the inward rectifier potassium channel family. The encoded protein has a small unitary conductance compared to other members of this protein family. Two transcript variants encoding the same protein have been found for this gene.
• Uniprot ID: P48050
• Protein Accession #: NP_004972
• Nucleotide Accession #: NM_004981
• Protein Size (# AA): 445
• Molecular Weight: 49kDa
• Protein Interactions: SNTA1; LIN7B; GNGT2; DLG2; IL16; DLG4; DLG1; KCNJ2; CASK; PRKCD; LIN7C; LIN7A; DMD;