GGTL3 Antibody - C-terminal region (ARP49139_P050)

Catalog No: ARP49139_P050

WB Suggested Anti-GGTL3 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human brain

Host: Rabbit
Target: GGT7
Positive control (+): Human Brain (BR)
Negative control (-): Human Liver (LI)
Antibody concentration: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GGTL3
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: ILLNSQMLDFSWPNRTANHSAPSLENSVQPGKRPLSFLLPTVVRPAEGLC
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-GGT7 (ARP49139_P050) antibody is Catalog # AAP49139 (Previous Catalog # AAPY02335)
• Reference: Heisterkamp,N., (2008) Hum. Genet. 123 (4), 321-332

Target Info

• Gene Symbol: GGT7
• Gene Full Name: Gamma-glutamyltransferase 7
• Alias Symbols: GGT4, GGTL3, GGTL5, D20S101
• NCBI Gene Id: 2686
• Protein Name: Putative gamma-glutamyltransferase light chain 3
• Description of Target: GGTL3 is an enzymes involved in both the metabolism of glutathione and in the transpeptidation of amino acids. Changes in the activity of gamma-glutamyltransferase may signal preneoplastic or toxic conditions in the liver or kidney. GGTL3 consists of a heavy and a light chain, and it can interact with CT120, a plasma membrane-associated protein that is possibly involved in lung carcinogenesis.This gene is a member of a gene family that encodes enzymes involved in both the metabolism of glutathione and in the transpeptidation of amino acids. Changes in the activity of gamma-glutamyltransferase may signal preneoplastic or toxic conditions in the liver or kidney. The protein encoded by this gene consists of a heavy and a light chain, and it can interact with CT120, a plasma membrane-associated protein that is possibly involved in lung carcinogenesis. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.
• Uniprot ID: B5MD39
• Protein Accession #: NP_821158
• Nucleotide Accession #: NM_178026
• Protein Size (# AA): 662
• Molecular Weight: 70kDa
• Protein Interactions: TMEM242; LHFPL5; MALL; GPR25; FAM96B; DCP2; GGT7; FAM57A;