SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP47044_P050
Price: $0.00
SKU
ARP47044_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

ERVW-1 Antibody - N-terminal region (ARP47044_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-ERVW-1 (ARP47044_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human ERVW-1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%; Rat: 86%
Peptide SequenceSynthetic peptide located within the following region: CMTSSSPYQEFLWRMQRPGNIDAPSYRSLSKGTPTFTAHTHMPRNCYHSA
Concentration0.5 mg/ml
Blocking PeptideFor anti-ERVW-1 (ARP47044_P050) antibody is Catalog # AAP47044
Enhanced Validation
Relative Expression (Western Blot) Avivasheild
Gene SymbolERVW-1
Gene Full Nameendogenous retrovirus group W, member 1
Alias SymbolsENV, ENVW, HERVW, ERVWE1, HERV7Q, HERV-7q, HERVWENV, HERV-W-ENV
NCBI Gene Id30816
Protein NameHERV-W_7q21.2 provirus ancestral Env polyprotein
Description of TargetERVWE1 or syncytin, is expressed in the placental syncytiotrophoblast and is involved in fusion of the cytotrophoblast cells to form the syncytial layer of the placenta. The protein has the characteristics of a typical retroviral envelope protein, including a furin cleavage site that separates the surface (SU) and transmembrane (TM) proteins which form a heterodimer. Alternatively spliced transcript variants encoding the same protein have been found for this gene.
Uniprot IDQ9UQF0
Protein Accession #NP_055405
Nucleotide Accession #NM_014590
Protein Size (# AA)538
Molecular Weight60 kDa
Protein InteractionsSLC1A4; SLC1A5;
  1. What is the species homology for "ERVW-1 Antibody - N-terminal region (ARP47044_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Rat".

  2. How long will it take to receive "ERVW-1 Antibody - N-terminal region (ARP47044_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ERVW-1 Antibody - N-terminal region (ARP47044_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ERVW-1 Antibody - N-terminal region (ARP47044_P050)"?

    This target may also be called "ENV, ENVW, HERVW, ERVWE1, HERV7Q, HERV-7q, HERVWENV, HERV-W-ENV" in publications.

  5. What is the shipping cost for "ERVW-1 Antibody - N-terminal region (ARP47044_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ERVW-1 Antibody - N-terminal region (ARP47044_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ERVW-1 Antibody - N-terminal region (ARP47044_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "60 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ERVW-1 Antibody - N-terminal region (ARP47044_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ERVW-1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ERVW-1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ERVW-1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ERVW-1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ERVW-1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ERVW-1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ERVW-1 Antibody - N-terminal region (ARP47044_P050)
Your Rating
We found other products you might like!