USP16 antibody - N-terminal region (ARP45772_T100)

Catalog#: ARP45772_T100

• Size: 100ug

Human HepG2

• Description of Target: USP16 is a deubiquitinating enzyme that is phosphorylated at the onset of mitosis and then dephosphorylated at the metaphase/anaphase transition. It can deubiquitinate H2A, one of two major ubiquitinated proteins of chromatin, in vitro and a mutant form of the protein was shown to block cell division.
• Gene Symbol: USP16
• Official Gene Full Name: Ubiquitin specific peptidase 16
• Alias Symbols: UBP-M
• Protein Accession#: AAR13293
• Nucleotide Accession#: NM_001001992
• Swissprot Id: Q5VKN8
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 408
• Molecular Weight: 44kDa
• Application: WB
• Partner Proteins: ATN1, COPS6, KRTAP4-12, PFKM, PRPF40A, COPS6, DMWD, KRTAP4-12, TAF10, TAF13
• Immunogen: The immunogen for anti-USP16 antibody: synthetic peptide directed towards the N terminal of human USP16
• Product Format: Lyophilized powder
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Dog: 92%; Guinea pig: 85%; Rabbit: 85%; Mouse: 78%
• Peptide Sequence: Synthetic peptide located within the following region: CKTDNKVKDKAEEETEEKPSVWLCLKCGHQGCGRNSQEQHALKHYLTPRS
• Blocking Peptide: For anti-USP16 antibody is Catalog # AAP45772 (Previous Catalog # AAPP26935)
• Reconstitution and Storage: Add 100 μl of distilled water. Final anti-USP16 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: USP16 antibody tested with Human Hepg2 Cells (ARP45772_T100)

Aviva Systems Biology is the original manufacturer of this USP16 antibody (ARP45772_T100)

Click here to view the USP16 antibody Western Blot Protocol

Product Datasheet Link: USP16 antibody (ARP45772_T100)

WB Suggested Anti-USP16 Antibody Titration: 2.5ug/ml
Positive Control: HepG2

Western Blot image:


Description of Target: USP16 is a deubiquitinating enzyme that is phosphorylated at the onset of mitosis and then dephosphorylated at the metaphase/anaphase transition. It can deubiquitinate H2A, one of two major ubiquitinated proteins of chromatin, in vitro and a mutant form of the protein was shown to block cell division.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s USP16 antibody (ARP45772_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

Product Review: USP16 antibody-N-terminal region (ARP45772_T100) in Human brain stem cells (NT2) using IHC

Product Page for USP16 antibody-N-terminal region (ARP45772_T100)

Researcher:Dr. Yuzhi Chen, University of Arkansas for Medical Science
Application:IHC
Species+tissue/cell type: Human brain stem cells (NT2)
Primary antibody dilution: 1:500
Secondary antibody:Goat anti-rabbit Alexa Fluor 594
Secondary antibody dilution:1:1000

 

IHC:

Incubate cells with 2N HCL for 30 min
Wash 3X in PBS
Stained for 1h 30 min with 1:500 antibody
Wash 3X in PBS
Incubated with goat anti-rabbit Alexa-Fluor 594 for 1h
Wash 3X in PBS
Co stain with DAPI
Images were taken with a 40X objective