- Description of Target:
- The function of this protein remains unknown.
- Gene Symbol:
- Ubb
- Official Gene Full Name:
- Ubiquitin B
- Alias Symbols:
- AL033289; Rps27a; Uba52; Ubb2; Ubc
- Tissue Tool:
- Find tissues and cell lines supported to express Ubb.
- Protein Accession# :
- NP_035794
- Nucleotide Accession#:
- NM_011664
- Swissprot Id:
- Q78XY9
- Host:
- Rabbit
- Protein Size (# AA):
- 305
- Molecular Weight:
- 34kDa
- Application:
- WB
- Partner Proteins:
- Egln3,Polk,SMAD4,SMURF1,TGFBR1
- Product Format:
- Lyophilized powder
- Complete computational species homology data:
- Ubb antibody - N-terminal region (ARP62990_P050)
- Predicted Homology Based on Immunogen Sequence:
- Bovine: 100%; Chicken: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
- Datasheets / Downloads:
- Printable datasheet for
anti-Ubb antibody
- ARP62990_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: KEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVK
- Blocking Peptide:
- For anti-Ubb antibody is Catalog # AAP62990
- Key Reference:
- N/A
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-Ubb antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
