TIMP1 Antibody - N-terminal region (ARP59178_P050)

Catalog No: ARP59178_P050

Host: Rabbit
Target Name: TIMP1
Sample Type: Fetal Kidney lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human TIMP1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 86%; Goat: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 79%; Rabbit: 79%; Rat: 79%; Sheep: 93%
• Peptide Sequence: Synthetic peptide located within the following region: QRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLI
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TIMP1 (ARP59178_P050) antibody is Catalog # AAP59178

Target Info

• Gene Symbol: TIMP1
• Gene Full Name: TIMP metallopeptidase inhibitor 1
• Alias Symbols: EPA, EPO, HCI, CLGI, TIMP, TIMP-1
• NCBI Gene Id: 7076
• Protein Name: TIMP metallopeptidase inhibitor 1 EMBL CAI42465.1
• Description of Target: This gene belongs to the TIMP gene family. The proteins encoded by this gene family are natural inhibitors of the matrix metalloproteinases (MMPs), a group of peptidases involved in degradation of the extracellular matrix. In addition to its inhibitory role against most of the known MMPs, the encoded protein is able to promote cell proliferation in a wide range of cell types, and may also have an anti-apoptotic function. Transcription of this gene is highly inducible in response to many cytokines and hormones. In addition, the expression from some but not all inactive X chromosomes suggests that this gene inactivation is polymorphic in human females. This gene is located within intron 6 of the synapsin I gene and is transcribed in the opposite direction.
• Uniprot ID: Q6FGX5
• Protein Accession #: NP_003245
• Nucleotide Accession #: NM_003254
• Protein Size (# AA): 207
• Molecular Weight: 23kDa
• Protein Interactions: UBC; FBXO6; MYOC; ZBTB16; RECQL5; ECH1; EEF1B2; MMP3; CD63; MMP2; MMP1;