SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP73724_P050
Price: $0.00
SKU
ARP73724_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-TAOK1 (ARP73724_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Human TAOK1
PurificationAffinity Purified
Peptide SequenceSynthetic peptide located within the following region: SDDKSELDMMEGDHTVMSNSSVIHLKPEEENYREEGDPRTRASDPQSPPQ
Concentration0.5 mg/ml
Blocking PeptideFor anti-TAOK1 (ARP73724_P050) antibody is Catalog # AAP73724
Gene SymbolTAOK1
Alias SymbolsPSK2, TAO1, KFC-B, MARKK, PSK-2, hKFC-B, hTAOK1, MAP3K16
NCBI Gene Id57551
Description of TargetTAOK1 is a Serine/threonine-protein kinase involved in various processes such as p38/MAPK14 stress-activated MAPK cascade, DNA damage response and regulation of cytoskeleton stability. TAOK1 phosphorylates MAP2K3, MAP2K6 and MARK2. It acts as an activator of the p38/MAPK14 stress-activated MAPK cascade by mediating phosphorylation and subsequent activation of the upstream MAP2K3 and MAP2K6 kinases. It is involved in G-protein coupled receptor signaling to p38/MAPK14. In response to DNA damage, It is involved in the G2/M transition DNA damage checkpoint by activating the p38/MAPK14 stress-activated MAPK cascade, probably by mediating phosphorylation of MAP2K3 and MAP2K6. TAOK1 acts as a regulator of cytoskeleton stability by phosphorylating 'Thr-208' of MARK2, leading to activate MARK2 kinase activity and subsequent phosphorylation and detachment of MAPT/TAU from microtubules. TAOK1 also acts as a regulator of apoptosis: regulates apoptotic morphological changes, including cell contraction, membrane blebbing and apoptotic bodies formation via activation of the MAPK8/JNK cascade.
Uniprot IDQ7L7X3-2
Protein Size (# AA)398
Molecular Weight43kDa
Protein InteractionsSTK26; STK25; UBC; MAP3K7; SRBD1; GEMIN7; C8orf33; WT1; DYNC1I1; CSNK1E; STK4; MARK1; MAP2K3;
  1. What is the species homology for "TAOK1 Antibody - middle region (ARP73724_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "TAOK1 Antibody - middle region (ARP73724_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TAOK1 Antibody - middle region (ARP73724_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TAOK1 Antibody - middle region (ARP73724_P050)"?

    This target may also be called "PSK2, TAO1, KFC-B, MARKK, PSK-2, hKFC-B, hTAOK1, MAP3K16" in publications.

  5. What is the shipping cost for "TAOK1 Antibody - middle region (ARP73724_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TAOK1 Antibody - middle region (ARP73724_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TAOK1 Antibody - middle region (ARP73724_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "43kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TAOK1 Antibody - middle region (ARP73724_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TAOK1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TAOK1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TAOK1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TAOK1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TAOK1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TAOK1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TAOK1 Antibody - middle region (ARP73724_P050)
Your Rating
We found other products you might like!