SESN1 Antibody - middle region (ARP55059_P050)

Catalog No: ARP55059_P050

Host: Rabbit
Target Name: SESN1
Sample Type: THP-1 Whole cell lysates
Antibody Dilution: 1.0ug/ml

Host: Mouse
Target Name: SESN1
Sample Tissue: Mouse Spleen
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human, Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human SESN1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 79%
• Peptide Sequence: Synthetic peptide located within the following region: KWLNGLENAPQKLQNLGELNKVLAHRPWLITKEHIEGLLKAEEHSWSLAE
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SESN1 (ARP55059_P050) antibody is Catalog # AAP55059

Target Info

• Gene Symbol: SESN1
• Gene Full Name: sestrin 1
• Alias Symbols: PA26, SEST1
• NCBI Gene Id: 27244
• Protein Name: Sestrin-1
• Description of Target: This gene encodes a member of the sestrin family. Sestrins are induced by the p53 tumor suppressor protein and play a role in the cellular response to DNA damage and oxidative stress. The encoded protein mediates p53 inhibition of cell growth by activating AMP-activated protein kinase, which results in the inhibition of the mammalian target of rapamycin protein. The encoded protein also plays a critical role in antioxidant defense by regenerating overoxidized peroxiredoxins, and the expression of this gene is a potential marker for exposure to radiation. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
• Uniprot ID: Q9Y6P5-2
• Protein Accession #: NP_055269
• Nucleotide Accession #: NM_014454
• Protein Size (# AA): 551
• Molecular Weight: 64kDa
• Protein Interactions: UBC; RBX1; KEAP1; SQSTM1; PRDX1;