RPL10A Antibody - middle region (ARP56728_P050)

Catalog No: ARP56728_P050

WB Suggested Anti-RPL10A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RPL10A
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: YDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENMVAKVDEVKSTIK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-RPL10A (ARP56728_P050) antibody is Catalog # AAP56728 (Previous Catalog # AAPP42003)

Target Info

• Gene Symbol: RPL10A
• Gene Full Name: Ribosomal protein L10a
• Alias Symbols: L10A, CSA19, NEDD6, Csa-19
• NCBI Gene Id: 4736
• Protein Name: 60S ribosomal protein L10a
• Description of Target: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L1P family of ribosomal proteins. It is located in the cytoplasm. The expression of this gene is downregulated in the thymus by cyclosporin-A (CsA), an immunosuppressive drug. Studies in mice have shown that the expression of the ribosomal protein L10a gene is downregulated in neural precursor cells during development. This gene previously was referred to as NEDD6 (neural precursor cell expressed, developmentally downregulated 6), but it has been renamed RPL10A (ribosomal protein 10a). As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
• Uniprot ID: P62906
• Protein Accession #: NP_009035
• Nucleotide Accession #: NM_007104
• Protein Size (# AA): 217
• Molecular Weight: 25kDa
• Protein Interactions: RGS17; HUWE1; CEP250; TUBG1; TP53; UBC; MDM2; RNF2; TARDBP; YWHAQ; PAN2; UBL4A; VCAM1; SRPR; ITGA4; FN1; ACTB; ESR1; RPLP0P6; RPL10L; RAD18; RPS27L; RPL23; RPL14; S100A10; RPS28; RPS27A; RPS26; RPS25; RPS24; RPS23; RPS21; RPS20; RPS19; RPS16; RPS15A; RPS1