Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: ARP63823_P050
Price: $0.00
SKU
ARP63823_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-PDGFA (ARP63823_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Dog, Guinea Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human PDGFA
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 85%; Guinea Pig: 82%; Human: 100%; Mouse: 85%; Rat: 85%
Peptide SequenceSynthetic peptide located within the following region: HRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTDVR
Concentration0.5 mg/ml
Blocking PeptideFor anti-PDGFA (ARP63823_P050) antibody is Catalog # AAP63823
Gene SymbolPDGFA
Gene Full Nameplatelet-derived growth factor alpha polypeptide
Alias SymbolsPDGF1, PDGF-A
NCBI Gene Id5154
Protein NamePlatelet-derived growth factor subunit A
Description of TargetThe protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a motif of eight cysteines. This gene product can exist either as a homodimer or as a heterodimer with the platelet-derived growth factor beta polypeptide, where the dimers are connected by disulfide bonds. Studies using knockout mice have shown cellular defects in oligodendrocytes, alveolar smooth muscle cells, and Leydig cells in the testis; knockout mice die either as embryos or shortly after birth. Two splice variants have been identified for this gene.
Uniprot IDP04085-2
Protein Accession #NP_148983
Nucleotide Accession #NM_033023
Protein Size (# AA)196
Molecular Weight21kDa
Protein InteractionsCOL6A1; COL5A1; COL4A1; COL3A1; COL2A1; COL1A2; COL1A1; PDAP1; DUSP3; SPARC; PDGFRA; PDGFA; HSPG2; FURIN; A2M; PLCG1;
  1. What is the species homology for "PDGFA Antibody - C-terminal region (ARP63823_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Dog, Guinea Pig".

  2. How long will it take to receive "PDGFA Antibody - C-terminal region (ARP63823_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PDGFA Antibody - C-terminal region (ARP63823_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PDGFA Antibody - C-terminal region (ARP63823_P050)"?

    This target may also be called "PDGF1, PDGF-A" in publications.

  5. What is the shipping cost for "PDGFA Antibody - C-terminal region (ARP63823_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PDGFA Antibody - C-terminal region (ARP63823_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PDGFA Antibody - C-terminal region (ARP63823_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "21kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PDGFA Antibody - C-terminal region (ARP63823_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PDGFA"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PDGFA"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PDGFA"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PDGFA"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PDGFA"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PDGFA"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PDGFA Antibody - C-terminal region (ARP63823_P050)
Your Rating
We found other products you might like!